Recombinant Human TREM2 Protein, Fc-tagged
Cat.No. : | TREM2-30H |
Product Overview : | Recombinant Human TREM2 Protein, fused to Fc-tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Fc |
Description : | This gene encodes a membrane protein that forms a receptor signaling complex with the TYRO protein tyrosine kinase binding protein. The encoded protein functions in immune response and may be involved in chronic inflammation by triggering the production of constitutive inflammatory cytokines. Defects in this gene are a cause of polycystic lipomembranous osteodysplasia with sclerosing leukoencephalopathy (PLOSL). Alternative splicing results in multiple transcript variants encoding different isoforms. |
Form : | 50mM Tris 7.5, 100mM Glycine, 25mM Arginine, 150mM NaCl. |
Molecular Mass : | 43.6 kDa |
AA Sequence : | HNTTVFQGVAGQSLQVSCPYDSMKHWGRHKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTSEPKSSDKTHTCPPCPAPEAEGAPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPSSIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Purity : | >95% |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Gene Name | TREM2 triggering receptor expressed on myeloid cells 2 [ Homo sapiens (human) ] |
Official Symbol | TREM2 |
Synonyms | PLOSL2; TREM-2; Trem2a; Trem2b; Trem2c |
Gene ID | 54209 |
mRNA Refseq | NM_018965 |
Protein Refseq | NP_061838 |
MIM | 605086 |
UniProt ID | Q9NZC2 |
◆ Recombinant Proteins | ||
TREM2-283H | Recombinant Human TREM2 protein, hFc-tagged | +Inquiry |
TREM2-486H | Recombinant Human TREM2 Protein, His-tagged | +Inquiry |
TREM2-161H | Recombinant Human TREM2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Trem2-6616M | Recombinant Mouse Trem2 Protein (Lys19-Thr227), C-Fc tagged | +Inquiry |
Trem2-536R | Recombinant Rat Trem2 Protein, His/GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TREM2-2649HCL | Recombinant Human TREM2 cell lysate | +Inquiry |
TREM2-2186MCL | Recombinant Mouse TREM2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TREM2 Products
Required fields are marked with *
My Review for All TREM2 Products
Required fields are marked with *
0
Inquiry Basket