Recombinant Human TREM2 Protein, Fc-tagged

Cat.No. : TREM2-30H
Product Overview : Recombinant Human TREM2 Protein, fused to Fc-tag, was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Fc
Description : This gene encodes a membrane protein that forms a receptor signaling complex with the TYRO protein tyrosine kinase binding protein. The encoded protein functions in immune response and may be involved in chronic inflammation by triggering the production of constitutive inflammatory cytokines. Defects in this gene are a cause of polycystic lipomembranous osteodysplasia with sclerosing leukoencephalopathy (PLOSL). Alternative splicing results in multiple transcript variants encoding different isoforms.
Form : 50mM Tris 7.5, 100mM Glycine, 25mM Arginine, 150mM NaCl.
Molecular Mass : 43.6 kDa
AA Sequence : HNTTVFQGVAGQSLQVSCPYDSMKHWGRHKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTSEPKSSDKTHTCPPCPAPEAEGAPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPSSIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Purity : >95%
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Gene Name TREM2 triggering receptor expressed on myeloid cells 2 [ Homo sapiens (human) ]
Official Symbol TREM2
Synonyms PLOSL2; TREM-2; Trem2a; Trem2b; Trem2c
Gene ID 54209
mRNA Refseq NM_018965
Protein Refseq NP_061838
MIM 605086
UniProt ID Q9NZC2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TREM2 Products

Required fields are marked with *

My Review for All TREM2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon