Recombinant Human TREML1 Protein, Fc-tagged
Cat.No. : | TREML1-373H |
Product Overview : | Recombinant Human TREML1 fused with Fc tag at C-terminal was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Fc |
Description : | This gene encodes a member of the triggering receptor expressed on myeloid cells-like (TREM) family. The encoded protein is a type 1 single Ig domain orphan receptor localized to the alpha-granule membranes of platelets. The encoded protein is involved in platelet aggregation, inflammation, and cellular activation and has been linked to Gray platelet syndrome. Alternative splicing results in multiple transcript variants |
Form : | Lyophilized from a 0.2 µM filtered solution of PBS, pH 7.4 |
Molecular Mass : | 42.9kD |
AA Sequence : | QGIVGSLPEVLQAPVGSSILVQCHYRLQDVKAQKVWCRFLPEGCQPLVSSAVDRRAPAGRRTFLTDLGGGLLQVEMVTLQEEDAGEYGCMVDGARGPQILHRVSLNILPPEEEEETHKIGSLAENAFSDPAGSANPLEPSQDEKSIPVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | TREML1 triggering receptor expressed on myeloid cells-like 1 [ Homo sapiens ] |
Official Symbol | TREML1 |
Synonyms | TREML1; triggering receptor expressed on myeloid cells-like 1; trem-like transcript 1 protein; dJ238O23.3; TLT1; TREM like transcript 1; triggering receptor expressed on myeloid cells-like protein 1; TLT-1; PRO3438; GLTL1825; MGC119173; |
Gene ID | 340205 |
mRNA Refseq | NM_178174 |
Protein Refseq | NP_835468 |
MIM | 609714 |
UniProt ID | Q86YW5 |
◆ Recombinant Proteins | ||
TREML1-373H | Recombinant Human TREML1 Protein, Fc-tagged | +Inquiry |
TREML1-4949R | Recombinant Rhesus monkey TREML1 Protein, His-tagged | +Inquiry |
Treml1-9580M | Recombinant Mouse Treml1 Protein, His (Fc)-Avi-tagged | +Inquiry |
TREML1-1567H | Recombinant Human TREML1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TREML1-3401H | Recombinant Human TREML1, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TREML1-2084HCL | Recombinant Human TREML1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TREML1 Products
Required fields are marked with *
My Review for All TREML1 Products
Required fields are marked with *
0
Inquiry Basket