Recombinant Human TREML1 Protein, Fc-tagged

Cat.No. : TREML1-373H
Product Overview : Recombinant Human TREML1 fused with Fc tag at C-terminal was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Fc
Description : This gene encodes a member of the triggering receptor expressed on myeloid cells-like (TREM) family. The encoded protein is a type 1 single Ig domain orphan receptor localized to the alpha-granule membranes of platelets. The encoded protein is involved in platelet aggregation, inflammation, and cellular activation and has been linked to Gray platelet syndrome. Alternative splicing results in multiple transcript variants
Form : Lyophilized from a 0.2 µM filtered solution of PBS, pH 7.4
Molecular Mass : 42.9kD
AA Sequence : QGIVGSLPEVLQAPVGSSILVQCHYRLQDVKAQKVWCRFLPEGCQPLVSSAVDRRAPAGRRTFLTDLGGGLLQVEMVTLQEEDAGEYGCMVDGARGPQILHRVSLNILPPEEEEETHKIGSLAENAFSDPAGSANPLEPSQDEKSIPVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Concentration : Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name TREML1 triggering receptor expressed on myeloid cells-like 1 [ Homo sapiens ]
Official Symbol TREML1
Synonyms TREML1; triggering receptor expressed on myeloid cells-like 1; trem-like transcript 1 protein; dJ238O23.3; TLT1; TREM like transcript 1; triggering receptor expressed on myeloid cells-like protein 1; TLT-1; PRO3438; GLTL1825; MGC119173;
Gene ID 340205
mRNA Refseq NM_178174
Protein Refseq NP_835468
MIM 609714
UniProt ID Q86YW5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TREML1 Products

Required fields are marked with *

My Review for All TREML1 Products

Required fields are marked with *

0
cart-icon