Recombinant Human TRIM21, GST-tagged
| Cat.No. : | TRIM21-106H |
| Product Overview : | Human TRIM21 full-length ORF (1 a.a. - 475 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The encoded protein is part of the RoSSA ribonucleoprotein, which includes a single polypeptide and one of four small RNA molecules. The RoSSA particle localizes to both the cytoplasm and the nucleus. RoSSA interacts with autoantigens in patients with Sjogren syndrome and systemic lupus erythematosus. Alternatively spliced transcript variants for this gene have been described but the full-length nature of only one has been determined. |
| Molecular Mass : | 77.99 kDa |
| AA Sequence : | MASAARLTMMWEEVTCPICLDPFVEPVSIECGHSFCQECISQVGKGGGSVCPVCRQRFLLKNLRPNRQLANMVNN LKEISQEAREGTQGERCAV HGERLHLFCEKDGKALCWVCAQSRKHRDHAMVPLEEAAQEYQEKLQVALGELRRK QELAEKLEVEIAIKRADWKKTVETQKSRIHAEFVQQKNF LVEEEQRQLQELEKDEREQLRILGEKEAKLAQQSQ ALQELISELDRRCHSSALELLQEVIIVLERSESWNLKDLDITSPELRSVCHVPGLKKML RTCAVHITLDPDTAN PWLILSEDRRQVRLGDTQQSIPGNEERFDSYPMVLGAQHFHSGKHYWEVDVTGKEAWDLGVCRDSVRRKGHFLLS SKSG FWTIWLWNKQKYEAGTYPQTPLHLQVPPCQVGIFLDYEAGMVSFYNITDHGSLIYSFSECAFTGPLRPFF SPGFNDGGKNTAPLTLCPLNIGSQGSTDY |
| Applications : | ELISA; WB-Re; AP; Array |
| Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | TRIM21 tripartite motif containing 21 [ Homo sapiens (human) ] |
| Official Symbol | TRIM21 |
| Synonyms | TRIM21; SSA; RO52; SSA1; RNF81; tripartite motif containing 21; E3 ubiquitin-protein ligase TRIM21; SS-A; ro(SS-A); 52 kDa Ro protein; RING finger protein 81; Sicca syndrome antigen A; tripartite motif-containing 21; sjoegren syndrome type A antigen; tripartite motif-containing protein 21; 52 kDa ribonucleoprotein autoantigen Ro/SS-A; Sjogren syndrome antigen A1 (52kDa, ribonucleoprotein autoantigen SS-A/Ro) |
| Gene ID | 6737 |
| mRNA Refseq | NM_003141 |
| Protein Refseq | NP_003132 |
| MIM | 109092 |
| UniProt ID | P19474 |
| Chromosome Location | 11p15.5 |
| Pathway | Adaptive Immune System; Antigen processing: Ubiquitination & Proteasome degradation; Cytosolic sensors of pathogen-associated DNA |
| Function | DNA binding; RNA binding; ubiquitin-protein ligase activity |
| ◆ Recombinant Proteins | ||
| TRIM21-3037H | Recombinant Human TRIM21 protein, His-tagged | +Inquiry |
| TRIM21-11H | Recombinant Full Length Human TRIM21 Protein (1-475), C-His-tagged | +Inquiry |
| TRIM21-196H | Recombinant Human tripartite motif-containing 21 | +Inquiry |
| Trim21-7433MB | Recombinant Mouse Trim21 Protein, His&Avi-tagged, Biotinylated | +Inquiry |
| TRIM21-105H | Recombinant Full Length Human TRIM21, MYC/DDK-tagged | +Inquiry |
| ◆ Native Proteins | ||
| TRIM21-212B | Native Cow TRIM21 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TRIM21-791HCL | Recombinant Human TRIM21 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TRIM21 Products
Required fields are marked with *
My Review for All TRIM21 Products
Required fields are marked with *




