Recombinant Human TRIM38 protein, His-tagged
Cat.No. : | TRIM38-3020H |
Product Overview : | Recombinant Human TRIM38 protein(Q14524)(Cys31-Leu260), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Cys31-Leu260 |
Tag : | C-His |
Form : | Phosphate buffered saline. |
Molecular Mass : | 29 KDa |
Storage : | Store at -20°C to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | CGHSYCHLCITDFFKNPSQKQLRQETFCCPQCRAPFHMDSLRPNKQLGSLIEALKETDQEMSCEEHGEQFHLFCEDEGQLICWRCERAPQHKGHTTALVEDVCQGYKEKLQKAVTKLKQLEDRCTEQKLSTAMRITKWKEKVQIQRQKIRSDFKNLQCFLHEEEKSYLWRLEKEEQQTLSRLRDYEAGLGLKSNELKSHILELEEKCQGSAQKLLQNVNDTLSRSWAVKL |
Gene Name | TRIM38 tripartite motif containing 38 [ Homo sapiens ] |
Official Symbol | TRIM38 |
Synonyms | TRIM38; tripartite motif containing 38; ring finger protein 15 , RNF15, tripartite motif containing 38; tripartite motif-containing protein 38; RORET; ring finger protein 15; zinc finger protein RoRet; zinc-finger protein RoRet; tripartite motif-containing 38; Ro/SSA ribonucleoprotein homolog; RNF15; MGC8946; |
Gene ID | 10475 |
mRNA Refseq | NM_006355 |
Protein Refseq | NP_006346 |
UniProt ID | O00635 |
◆ Recombinant Proteins | ||
TRIM38-0418H | Recombinant Human TRIM38 Protein (A2-D465), GST tagged | +Inquiry |
TRIM38-3020H | Recombinant Human TRIM38 protein, His-tagged | +Inquiry |
TRIM38-3022H | Recombinant Human TRIM38 protein, His-tagged | +Inquiry |
TRIM38-32HFL | Recombinant Full Length Human tripartite motif containing 38 Protein, His&GST tagged | +Inquiry |
TRIM38-33HFL | Recombinant Full Length Human tripartite motif containing 38 Protein, GST tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRIM38-779HCL | Recombinant Human TRIM38 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TRIM38 Products
Required fields are marked with *
My Review for All TRIM38 Products
Required fields are marked with *