Recombinant Human TRIM38 protein, His-tagged

• Cat.No.: TRIM38-3020H
• Product Overview: Recombinant Human TRIM38 protein(Q14524)(Cys31-Leu260), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: Cys31-Leu260
• Tag: C-His
• Form: Phosphate buffered saline.
• Molecular Mass: 29 KDa
• Storage: Store at -20°C to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: CGHSYCHLCITDFFKNPSQKQLRQETFCCPQCRAPFHMDSLRPNKQLGSLIEALKETDQEMSCEEHGEQFHLFCEDEGQLICWRCERAPQHKGHTTALVEDVCQGYKEKLQKAVTKLKQLEDRCTEQKLSTAMRITKWKEKVQIQRQKIRSDFKNLQCFLHEEEKSYLWRLEKEEQQTLSRLRDYEAGLGLKSNELKSHILELEEKCQGSAQKLLQNVNDTLSRSWAVKL

Gene Information

• Gene Name: TRIM38 tripartite motif containing 38 [ Homo sapiens ]
• Official Symbol: TRIM38
• Synonyms: TRIM38; tripartite motif containing 38; ring finger protein 15 , RNF15, tripartite motif containing 38; tripartite motif-containing protein 38; RORET; ring finger protein 15; zinc finger protein RoRet; zinc-finger protein RoRet; tripartite motif-containing 38; Ro/SSA ribonucleoprotein homolog; RNF15; MGC8946
• Gene ID: 10475
• mRNA Refseq: NM_006355
• Protein Refseq: NP_006346
• UniProt ID: O00635