Recombinant Human TRPM7 Protein, GST tagged

• Cat.No.: TRPM7-32H
• Product Overview: Human TRPM7 partial ORF ( NP_060142.2, 777 a.a. - 855 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat germ cell free in vitro
• Tag: GST
• Protein Length: 777-855 aa
• Description: TRPCs, mammalian homologs of the Drosophila transient receptor potential (trp) protein, are ion channels that are thought to mediate capacitative calcium entry into the cell. TRP-PLIK is a protein that is both an ion channel and a kinase. As a channel, it conducts calcium and monovalent cations to depolarize cells and increase intracellular calcium. As a kinase, it is capable of phosphorylating itself and other substrates. The kinase activity is necessary for channel function, as shown by its dependence on intracellular ATP and by the kinase mutants.
• AASequence: KTKAEMSHIPQSQDAHQMTMDDSENNFQNITEEIPMEVFKEVRILDSNEGKNEMEIQMKSKKLPITRKFYAFYHAPIVK
• Molecular Mass: 34.43 kDa
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Application: Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array
• Note: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: TRPM7 transient receptor potential cation channel subfamily M member 7 [ Homo sapiens (human) ]
• Official Symbol: TRPM7
• Synonyms: TRPM7; transient receptor potential cation channel subfamily M member 7; CHAK; CHAK1; ALSPDC; LTRPC7; LTrpC-7; TRP-PLIK; transient receptor potential cation channel subfamily M member 7; LTRPC ion channel family member 7; channel-kinase 1; long transient receptor potential channel 7; transient receptor potential-phospholipase C-interacting kinase; EC 2.7.11.1
• Gene ID: 54822
• mRNA Refseq: NM_017672
• Protein Refseq: NP_060142
• MIM: 605692
• UniProt ID: Q6ZMF5