Recombinant Human TRPM7 Protein, GST tagged
Cat.No. : | TRPM7-32H |
Product Overview : | Human TRPM7 partial ORF ( NP_060142.2, 777 a.a. - 855 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat germ cell free in vitro |
Tag : | GST |
Protein Length : | 777-855 aa |
Description : | TRPCs, mammalian homologs of the Drosophila transient receptor potential (trp) protein, are ion channels that are thought to mediate capacitative calcium entry into the cell. TRP-PLIK is a protein that is both an ion channel and a kinase. As a channel, it conducts calcium and monovalent cations to depolarize cells and increase intracellular calcium. As a kinase, it is capable of phosphorylating itself and other substrates. The kinase activity is necessary for channel function, as shown by its dependence on intracellular ATP and by the kinase mutants. |
AASequence : | KTKAEMSHIPQSQDAHQMTMDDSENNFQNITEEIPMEVFKEVRILDSNEGKNEMEIQMKSKKLPITRKFYAFYHAPIVK |
Molecular Mass : | 34.43 kDa |
Quality Control Testing : | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Application : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Note : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | TRPM7 transient receptor potential cation channel subfamily M member 7 [ Homo sapiens (human) ] |
Official Symbol | TRPM7 |
Synonyms | TRPM7; transient receptor potential cation channel subfamily M member 7; CHAK; CHAK1; ALSPDC; LTRPC7; LTrpC-7; TRP-PLIK; transient receptor potential cation channel subfamily M member 7; LTRPC ion channel family member 7; channel-kinase 1; long transient receptor potential channel 7; transient receptor potential-phospholipase C-interacting kinase; EC 2.7.11.1 |
Gene ID | 54822 |
mRNA Refseq | NM_017672 |
Protein Refseq | NP_060142 |
MIM | 605692 |
UniProt ID | Q6ZMF5 |
◆ Recombinant Proteins | ||
TRPM7-1169HFL | Recombinant Human TRPM7 protein, His&Flag-tagged | +Inquiry |
TRPM7-3201Z | Recombinant Zebrafish TRPM7 | +Inquiry |
Trpm7-344R | Recombinant Rat Trpm7 Protein, His-tagged | +Inquiry |
TRPM7-4086C | Recombinant Chicken TRPM7 | +Inquiry |
◆ Native Proteins | ||
TRPM7-32H | Recombinant Human TRPM7 Protein, GST tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TRPM7 Products
Required fields are marked with *
My Review for All TRPM7 Products
Required fields are marked with *