Recombinant Human TRPM7 Protein, GST tagged

Cat.No. : TRPM7-32H
Product Overview : Human TRPM7 partial ORF ( NP_060142.2, 777 a.a. - 855 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat germ cell free in vitro
Tag : GST
Protein Length : 777-855 aa
Description : TRPCs, mammalian homologs of the Drosophila transient receptor potential (trp) protein, are ion channels that are thought to mediate capacitative calcium entry into the cell. TRP-PLIK is a protein that is both an ion channel and a kinase. As a channel, it conducts calcium and monovalent cations to depolarize cells and increase intracellular calcium. As a kinase, it is capable of phosphorylating itself and other substrates. The kinase activity is necessary for channel function, as shown by its dependence on intracellular ATP and by the kinase mutants.
AASequence : KTKAEMSHIPQSQDAHQMTMDDSENNFQNITEEIPMEVFKEVRILDSNEGKNEMEIQMKSKKLPITRKFYAFYHAPIVK
Molecular Mass : 34.43 kDa
Quality Control Testing : 12.5% SDS-PAGE Stained with Coomassie Blue.
Application : Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array
Note : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name TRPM7 transient receptor potential cation channel subfamily M member 7 [ Homo sapiens (human) ]
Official Symbol TRPM7
Synonyms TRPM7; transient receptor potential cation channel subfamily M member 7; CHAK; CHAK1; ALSPDC; LTRPC7; LTrpC-7; TRP-PLIK; transient receptor potential cation channel subfamily M member 7; LTRPC ion channel family member 7; channel-kinase 1; long transient receptor potential channel 7; transient receptor potential-phospholipase C-interacting kinase; EC 2.7.11.1
Gene ID 54822
mRNA Refseq NM_017672
Protein Refseq NP_060142
MIM 605692
UniProt ID Q6ZMF5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TRPM7 Products

Required fields are marked with *

My Review for All TRPM7 Products

Required fields are marked with *

0
cart-icon
0
compare icon