Recombinant Human TRPV1 protein, His-GST-tagged
Cat.No. : | TRPV1-8632H |
Product Overview : | Recombinant Human TRPV1 protein(Q8NER1)(1-155aa), fused with N-terminal His and GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST&His |
Protein Length : | 1-155aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 48.4 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MKKWSSTDLGAAADPLQKDTCPDPLDGDPNSRPPPAKPQLSTAKSRTRLFGKGDSEEAFPVDCPHEEGELDSCPTITVSPVITIQRPGDGPTGARLLSQDSVAASTEKTLRLYDRRSIFEAVAQNNCQDLESLLLFLQKSKKHLTDNEFKDPETG |
Gene Name | TRPV1 transient receptor potential cation channel, subfamily V, member 1 [ Homo sapiens ] |
Official Symbol | TRPV1 |
Synonyms | TRPV1; transient receptor potential cation channel, subfamily V, member 1; vanilloid receptor subtype 1 , VR1; transient receptor potential cation channel subfamily V member 1; OTRPC1; capsaicin receptor; osm-9-like TRP channel 1; vanilloid receptor subtype 1; transient receptor potential vanilloid 1a; transient receptor potential vanilloid 1b; VR1; DKFZp434K0220; |
Gene ID | 7442 |
mRNA Refseq | NM_018727 |
Protein Refseq | NP_061197 |
MIM | 602076 |
UniProt ID | Q8NER1 |
◆ Recombinant Proteins | ||
TRPV1-6141C | Recombinant Chicken TRPV1 | +Inquiry |
TRPV1-1174HFL | Recombinant Human TRPV1 protein, His&Flag-tagged | +Inquiry |
TRPV1-6303R | Recombinant Rat TRPV1 Protein | +Inquiry |
TRPV1-347M | Recombinant Mouse TRPV1 Protein, His&TRxA-tagged | +Inquiry |
TRPV1-5960R | Recombinant Rat TRPV1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRPV1-734HCL | Recombinant Human TRPV1 293 Cell Lysate | +Inquiry |
TRPV1-735HCL | Recombinant Human TRPV1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TRPV1 Products
Required fields are marked with *
My Review for All TRPV1 Products
Required fields are marked with *