Recombinant Human TRPV1 protein, His-GST-tagged

• Cat.No.: TRPV1-8632H
• Product Overview: Recombinant Human TRPV1 protein(Q8NER1)(1-155aa), fused with N-terminal His and GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST&His
• Protein Length: 1-155aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 48.4 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: MKKWSSTDLGAAADPLQKDTCPDPLDGDPNSRPPPAKPQLSTAKSRTRLFGKGDSEEAFPVDCPHEEGELDSCPTITVSPVITIQRPGDGPTGARLLSQDSVAASTEKTLRLYDRRSIFEAVAQNNCQDLESLLLFLQKSKKHLTDNEFKDPETG

Gene Information

• Gene Name: TRPV1 transient receptor potential cation channel, subfamily V, member 1 [ Homo sapiens ]
• Official Symbol: TRPV1
• Synonyms: TRPV1; transient receptor potential cation channel, subfamily V, member 1; vanilloid receptor subtype 1 , VR1; transient receptor potential cation channel subfamily V member 1; OTRPC1; capsaicin receptor; osm-9-like TRP channel 1; vanilloid receptor subtype 1; transient receptor potential vanilloid 1a; transient receptor potential vanilloid 1b; VR1; DKFZp434K0220
• Gene ID: 7442
• mRNA Refseq: NM_018727
• Protein Refseq: NP_061197
• MIM: 602076
• UniProt ID: Q8NER1