Recombinant Human TRPV1 protein, His-GST-tagged
| Cat.No. : | TRPV1-8632H |
| Product Overview : | Recombinant Human TRPV1 protein(Q8NER1)(1-155aa), fused with N-terminal His and GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST&His |
| Protein Length : | 1-155aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 48.4 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | MKKWSSTDLGAAADPLQKDTCPDPLDGDPNSRPPPAKPQLSTAKSRTRLFGKGDSEEAFPVDCPHEEGELDSCPTITVSPVITIQRPGDGPTGARLLSQDSVAASTEKTLRLYDRRSIFEAVAQNNCQDLESLLLFLQKSKKHLTDNEFKDPETG |
| Gene Name | TRPV1 transient receptor potential cation channel, subfamily V, member 1 [ Homo sapiens ] |
| Official Symbol | TRPV1 |
| Synonyms | TRPV1; transient receptor potential cation channel, subfamily V, member 1; vanilloid receptor subtype 1 , VR1; transient receptor potential cation channel subfamily V member 1; OTRPC1; capsaicin receptor; osm-9-like TRP channel 1; vanilloid receptor subtype 1; transient receptor potential vanilloid 1a; transient receptor potential vanilloid 1b; VR1; DKFZp434K0220; |
| Gene ID | 7442 |
| mRNA Refseq | NM_018727 |
| Protein Refseq | NP_061197 |
| MIM | 602076 |
| UniProt ID | Q8NER1 |
| ◆ Recombinant Proteins | ||
| TRPV1-6303R | Recombinant Rat TRPV1 Protein | +Inquiry |
| TRPV1-5960R | Recombinant Rat TRPV1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| TRPV1-0944H | Recombinant Human TRPV1 Full Length Transmembrane protein, Flag-tagged(Nanodisc) | +Inquiry |
| TRPV1-1174HFL | Recombinant Human TRPV1 protein, His&Flag-tagged | +Inquiry |
| TRPV1-6716Z | Recombinant Zebrafish TRPV1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TRPV1-734HCL | Recombinant Human TRPV1 293 Cell Lysate | +Inquiry |
| TRPV1-735HCL | Recombinant Human TRPV1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TRPV1 Products
Required fields are marked with *
My Review for All TRPV1 Products
Required fields are marked with *



