Recombinant Human TRPV1 protein, His-tagged

• Cat.No.: TRPV1-346H
• Product Overview: Recombinant Human TRPV1 protein(NP_061197)(1-203 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-203 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
• AA Sequence: MKKWSSTDLGAAADPLQKDTCPDPLDGDPNSRPPPAKPQLSTAKSRTRLFGKGDSEEAFPVDCPHEEGELDSCPTITVSPVITIQRPGDGPTGARLLSQDSVAASTEKTLRLYDRRSIFEAVAQNNCQDLESLLLFLQKSKKHLTDNEFKDPETGKTCLLKAMLNLHDGQNTTIPLLLEIARQTDSLKELVNASYTDSYYKGQ
• Purity: 75%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: TRPV1 transient receptor potential cation channel, subfamily V, member 1 [ Homo sapiens ]
• Official Symbol: TRPV1
• Synonyms: TRPV1; transient receptor potential cation channel, subfamily V, member 1; vanilloid receptor subtype 1 , VR1; transient receptor potential cation channel subfamily V member 1; OTRPC1; capsaicin receptor; osm-9-like TRP channel 1; vanilloid receptor subtype 1; transient receptor potential vanilloid 1a; transient receptor potential vanilloid 1b; VR1; DKFZp434K0220
• Gene ID: 7442
• mRNA Refseq: NM_018727
• Protein Refseq: NP_061197
• MIM: 602076
• UniProt ID: Q8NER1