Recombinant Human TRPV1 protein, His-tagged

Cat.No. : TRPV1-346H
Product Overview : Recombinant Human TRPV1 protein(NP_061197)(1-203 aa), fused to His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-203 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
AA Sequence : MKKWSSTDLGAAADPLQKDTCPDPLDGDPNSRPPPAKPQLSTAKSRTRLFGKGDSEEAFPVDCPHEEGELDSCPTITVSPVITIQRPGDGPTGARLLSQDSVAASTEKTLRLYDRRSIFEAVAQNNCQDLESLLLFLQKSKKHLTDNEFKDPETGKTCLLKAMLNLHDGQNTTIPLLLEIARQTDSLKELVNASYTDSYYKGQ
Purity : 75%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name TRPV1 transient receptor potential cation channel, subfamily V, member 1 [ Homo sapiens ]
Official Symbol TRPV1
Synonyms TRPV1; transient receptor potential cation channel, subfamily V, member 1; vanilloid receptor subtype 1 , VR1; transient receptor potential cation channel subfamily V member 1; OTRPC1; capsaicin receptor; osm-9-like TRP channel 1; vanilloid receptor subtype 1; transient receptor potential vanilloid 1a; transient receptor potential vanilloid 1b; VR1; DKFZp434K0220;
Gene ID 7442
mRNA Refseq NM_018727
Protein Refseq NP_061197
MIM 602076
UniProt ID Q8NER1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TRPV1 Products

Required fields are marked with *

My Review for All TRPV1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon