Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Join NIH Research Festival Biotech Vendor Exhibits 2024 | Sep. 25th, 2024

Recombinant Human TSC22D1, His-tagged

Cat.No. : TSC22D1-30748TH
Product Overview : Recombinant fragment, corresponding to amino acids 40-144 of Human TSC22D1 Isoform 2 with an N terminal His tag; Predicted MWt 12 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene encodes a member of the TSC22 domain family of leucine zipper transcription factors. The encoded protein is stimulated by transforming growth factor beta, and regulates the transcription of multiple genes including C-type natriuretic peptide. The encoded protein may play a critical role in tumor suppression through the induction of cancer cell apoptosis, and a single nucleotide polymorphism in the promoter of this gene has been associated with diabetic nephropathy. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:Reconstitute with 139 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : DNSSSGASVVAIDNKIEQAMDLVKSHLMYAVREEVEVLKE QIKELIEKNSQLEQENNLLKTLASPEQLAQFQAQLQTG SPPATTQPQGTTQPPAQPASQGSGPTA
Protein length : 40-144
Gene Name : TSC22D1 TSC22 domain family, member 1 [ Homo sapiens ]
Official Symbol : TSC22D1
Synonyms : TSC22D1; TSC22 domain family, member 1; TGFB1I4, transforming growth factor beta 1 induced transcript 4; TSC22 domain family protein 1; MGC17597; TSC22;
Gene ID : 8848
mRNA Refseq : NM_001243798
Protein Refseq : NP_001230727
MIM : 607715
Uniprot ID : Q15714
Chromosome Location : 13q14
Function : sequence-specific DNA binding transcription factor activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All TSC22D1 Products

Required fields are marked with *

My Review for All TSC22D1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /
  • Service lnquiry:

Stay Updated on the Latest Bioscience Trends