Recombinant Human TSLP Protein, 98-159aa, C-His tagged
Cat.No. : | TSLP-01H |
Product Overview : | Recombinant Human TSLP Protein (98-159aa) with C-His tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 98-159aa |
Description : | This gene encodes a hemopoietic cytokine proposed to signal through a heterodimeric receptor complex composed of the thymic stromal lymphopoietin receptor and the IL-7R alpha chain. It mainly impacts myeloid cells and induces the release of T cell-attracting chemokines from monocytes and enhances the maturation of CD11c(+) dendritic cells. The protein promotes T helper type 2 (TH2) cell responses that are associated with immunity in various inflammatory diseases, including asthma, allergic inflammation and chronic obstructive pulmonary disease. The protein is therefore considered a potential therapeutic target for the treatment of such diseases. In addition, the shorter (predominant) isoform is an antimicrobial protein, displaying antibacterial and antifungal activity against B. cereus, E. coli, E. faecalis, S. mitis, S. epidermidis, and C. albicans. Alternative splicing of this gene results in multiple transcript variants. |
AA Sequence : | MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQHHHHHH |
Endotoxin : | < 1 EU/μg protein by LAL |
Purity : | > 90% as determined by SDS-PAGE |
Storage : | Short Term Storage at +4 centigrade, Long Term, please prepare aliquots and store at -20 to -80 centigrade. Avoid freeze/thaw cycles. |
Storage Buffer : | PBS, pH 7.4 |
Gene Name | TSLP thymic stromal lymphopoietin [ Homo sapiens (human) ] |
Official Symbol | TSLP |
Synonyms | TSLP; thymic stromal lymphopoietin |
Gene ID | 85480 |
mRNA Refseq | NM_033035 |
Protein Refseq | NP_149024 |
MIM | 607003 |
UniProt ID | Q969D9 |
◆ Recombinant Proteins | ||
TSLP-500H | Recombinant Human TSLP Protein, His&GST-tagged | +Inquiry |
TSLP-372H | Recombinant Human TSLP protein, His-tagged | +Inquiry |
TSLP-0772R | Recombinant Rat TSLP protein, His-tagged | +Inquiry |
TSLP-258H | Recombinant Human TSLP Protein | +Inquiry |
TSLP-3191H | Recombinant Human TSLP protein, His-Avi-tagged, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
TSLP-1742MCL | Recombinant Mouse TSLP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TSLP Products
Required fields are marked with *
My Review for All TSLP Products
Required fields are marked with *