Recombinant Human TSPAN7 Protein (113-223 aa), His-tagged
Cat.No. : | TSPAN7-1547H |
Product Overview : | Recombinant Human TSPAN7 Protein (113-223 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 113-223 aa |
Description : | May be involved in cell proliferation and cell motility. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 14.5 kDa |
AA Sequence : | RHEIKDTFLRTYTDAMQTYNGNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMETNMGIIAGVAFGI |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | TSPAN7 tetraspanin 7 [ Homo sapiens ] |
Official Symbol | TSPAN7 |
Synonyms | TSPAN7; tetraspanin 7; A15; CD231; DXS1692E; TALLA 1; tspan-7; CD231 antigen; MXS1; MRX58; CCG-B7; TM4SF2; TALLA-1; TM4SF2b; |
Gene ID | 7102 |
mRNA Refseq | NM_004615 |
Protein Refseq | NP_004606 |
MIM | 300096 |
UniProt ID | P41732 |
◆ Recombinant Proteins | ||
TSPAN7-4818R | Recombinant Rhesus Macaque TSPAN7 Protein, His (Fc)-Avi-tagged | +Inquiry |
TSPAN7-1547H | Recombinant Human TSPAN7 Protein (113-223 aa), His-tagged | +Inquiry |
TSPAN7-5004R | Recombinant Rhesus monkey TSPAN7 Protein, His-tagged | +Inquiry |
TSPAN7-5141H | Recombinant Human TSPAN7 Protein (Arg113-Met213), C-His tagged | +Inquiry |
TSPAN7-923M | Recombinant Mouse TSPAN7 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TSPAN7-863HCL | Recombinant Human TSPAN7 cell lysate | +Inquiry |
TSPAN7-813CCL | Recombinant Cynomolgus TSPAN7 cell lysate | +Inquiry |
TSPAN7-861MCL | Recombinant Mouse TSPAN7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TSPAN7 Products
Required fields are marked with *
My Review for All TSPAN7 Products
Required fields are marked with *