Recombinant Human TUBA1A, His-tagged
| Cat.No. : | TUBA1A-31628TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 163-451 of Human TUBA1A with N terminal His tag; Predicted MWt 33 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 163-451 a.a. |
| Description : | Microtubules of the eukaryotic cytoskeleton perform essential and diverse functions and are composed of a heterodimer of alpha and beta tubulins. The genes encoding these microtubule constituents belong to the tubulin superfamily, which is composed of six distinct families. Genes from the alpha, beta and gamma tubulin families are found in all eukaryotes. The alpha and beta tubulins represent the major components of microtubules, while gamma tubulin plays a critical role in the nucleation of microtubule assembly. There are multiple alpha and beta tubulin genes, which are highly conserved among species. This gene encodes alpha tubulin and is highly similar to mouse and rat Tuba1 gene. Northern blotting studies have shown that the gene expression is predominantly found in morphologically differentiated neurologic cells. This gene is one of three alpha-tubulin genes in a cluster on chromosome 12q. |
| Conjugation : | HIS |
| Form : | Lyophilised:Reconstitute with 111 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | KKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAF MVDNEAIYICRRNLDIERPTYTNLNRLIGQIVSSITAS LRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAE KAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCL LYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKF DLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYE EVGVDSVEGEGEEEGEEY |
| Gene Name | TUBA1A tubulin, alpha 1a [ Homo sapiens ] |
| Official Symbol | TUBA1A |
| Synonyms | TUBA1A; tubulin, alpha 1a; tubulin alpha-1A chain; B ALPHA 1; FLJ25113; TUBA3; tubulin; alpha; brain specific; |
| Gene ID | 7846 |
| mRNA Refseq | NM_006009 |
| Protein Refseq | NP_006000 |
| MIM | 602529 |
| Uniprot ID | Q71U36 |
| Chromosome Location | 12q13.12 |
| Pathway | Cell Cycle, Mitotic, organism-specific biosystem; Centrosome maturation, organism-specific biosystem; Chaperonin-mediated protein folding, organism-specific biosystem; Cooperation of Prefoldin and TriC/CCTin actin and tubulin folding, organism-specific biosystem; Formation of tubulin folding intermediates by CCT/TriC, organism-specific biosystem; |
| Function | GTP binding; GTPase activity; nucleotide binding; protein domain specific binding; structural molecule activity; |
| ◆ Recombinant Proteins | ||
| TUBA1A-17608M | Recombinant Mouse TUBA1A Protein | +Inquiry |
| TUBA1A-17H | Recombinant Human TUBA1A protein, GST-tagged | +Inquiry |
| Tuba1a-5378M | Recombinant Mouse Tuba1a protein | +Inquiry |
| TUBA1A-6354R | Recombinant Rat TUBA1A Protein | +Inquiry |
| TUBA1A-533HF | Recombinant Full Length Human TUBA1A Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TUBA1A-662HCL | Recombinant Human TUBA1A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TUBA1A Products
Required fields are marked with *
My Review for All TUBA1A Products
Required fields are marked with *
