Recombinant Human TUBA1A, His-tagged

Cat.No. : TUBA1A-31628TH
Product Overview : Recombinant fragment, corresponding to amino acids 163-451 of Human TUBA1A with N terminal His tag; Predicted MWt 33 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 163-451 a.a.
Description : Microtubules of the eukaryotic cytoskeleton perform essential and diverse functions and are composed of a heterodimer of alpha and beta tubulins. The genes encoding these microtubule constituents belong to the tubulin superfamily, which is composed of six distinct families. Genes from the alpha, beta and gamma tubulin families are found in all eukaryotes. The alpha and beta tubulins represent the major components of microtubules, while gamma tubulin plays a critical role in the nucleation of microtubule assembly. There are multiple alpha and beta tubulin genes, which are highly conserved among species. This gene encodes alpha tubulin and is highly similar to mouse and rat Tuba1 gene. Northern blotting studies have shown that the gene expression is predominantly found in morphologically differentiated neurologic cells. This gene is one of three alpha-tubulin genes in a cluster on chromosome 12q.
Conjugation : HIS
Form : Lyophilised:Reconstitute with 111 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : KKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAF MVDNEAIYICRRNLDIERPTYTNLNRLIGQIVSSITAS LRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAE KAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCL LYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKF DLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYE EVGVDSVEGEGEEEGEEY
Gene Name TUBA1A tubulin, alpha 1a [ Homo sapiens ]
Official Symbol TUBA1A
Synonyms TUBA1A; tubulin, alpha 1a; tubulin alpha-1A chain; B ALPHA 1; FLJ25113; TUBA3; tubulin; alpha; brain specific;
Gene ID 7846
mRNA Refseq NM_006009
Protein Refseq NP_006000
MIM 602529
Uniprot ID Q71U36
Chromosome Location 12q13.12
Pathway Cell Cycle, Mitotic, organism-specific biosystem; Centrosome maturation, organism-specific biosystem; Chaperonin-mediated protein folding, organism-specific biosystem; Cooperation of Prefoldin and TriC/CCTin actin and tubulin folding, organism-specific biosystem; Formation of tubulin folding intermediates by CCT/TriC, organism-specific biosystem;
Function GTP binding; GTPase activity; nucleotide binding; protein domain specific binding; structural molecule activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TUBA1A Products

Required fields are marked with *

My Review for All TUBA1A Products

Required fields are marked with *

0
cart-icon