Recombinant Human TUBB2A protein(1-445aa), His-tagged
| Cat.No. : | TUBB2A-754H |
| Product Overview : | Recombinant Human TUBB2A protein(Q13885)(1-445aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-445aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 56.0 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEEGEDEA |
| Gene Name | TUBB2A tubulin, beta 2A class IIa [ Homo sapiens ] |
| Official Symbol | TUBB2A |
| Synonyms | TUBB2A; tubulin, beta 2A class IIa; TUBB, TUBB2, tubulin, beta 2 , tubulin, beta 2A , tubulin, beta polypeptide; tubulin beta-2A chain; class IIa beta tubulin; dJ40E16.7; class IIa beta-tubulin; tubulin, beta polypeptide 2; TUBB; TUBB2; |
| Gene ID | 7280 |
| mRNA Refseq | NM_001069 |
| Protein Refseq | NP_001060 |
| UniProt ID | Q13885 |
| ◆ Recombinant Proteins | ||
| TUBB2A-3634H | Recombinant Human TUBB2A protein, His-SUMO-tagged | +Inquiry |
| TUBB2A-805C | Recombinant Cynomolgus Monkey TUBB2A Protein, His (Fc)-Avi-tagged | +Inquiry |
| TUBB2A-4260H | Recombinant Human TUBB2A Protein, His (Fc)-Avi-tagged | +Inquiry |
| TUBB2A-105H | Recombinant Human TUBB2A, GST-tagged | +Inquiry |
| TUBB2A-6361R | Recombinant Rat TUBB2A Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TUBB2A-651HCL | Recombinant Human TUBB2A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TUBB2A Products
Required fields are marked with *
My Review for All TUBB2A Products
Required fields are marked with *
