Recombinant Human TXN Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : TXN-2132H
Product Overview : TXN MS Standard C13 and N15-labeled recombinant protein (NP_003320) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene acts as a homodimer and is involved in many redox reactions. The encoded protein is active in the reversible S-nitrosylation of cysteines in certain proteins, which is part of the response to intracellular nitric oxide. This protein is found in the cytoplasm. Two transcript variants encoding different isoforms have been found for this gene.
Molecular Mass : 11.7 kDa
AA Sequence : MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name TXN thioredoxin [ Homo sapiens (human) ]
Official Symbol TXN
Synonyms TXN; thioredoxin; TRX; ADF; SASP; TXN delta 3; ATL-derived factor; thioredoxin delta 3; surface-associated sulphydryl protein; TRDX; TRX1; MGC61975; DKFZp686B1993;
Gene ID 7295
mRNA Refseq NM_003329
Protein Refseq NP_003320
MIM 187700
UniProt ID P10599

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TXN Products

Required fields are marked with *

My Review for All TXN Products

Required fields are marked with *

0
cart-icon