Recombinant Human TXNDC12 protein, His-SUMO-tagged
Cat.No. : | TXNDC12-3638H |
Product Overview : | Recombinant Human TXNDC12 protein(O95881)(27-172aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 27-172aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 32.4 kDa |
AA Sequence : | HNGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPKDEDFSPDGGYIPRILFLDPSGKVHPEIINENGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFRKKHLEDEL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | TXNDC12 thioredoxin domain containing 12 (endoplasmic reticulum) [ Homo sapiens ] |
Official Symbol | TXNDC12 |
Synonyms | TXNDC12; thioredoxin domain containing 12 (endoplasmic reticulum); thioredoxin domain-containing protein 12; AGR1; anterior gradient homolog 1 (Xenopus laevis); endoplasmic reticulum thioredoxin superfamily member; 18 kDa; ERP18; ERP19; hAG 1; PDIA16; protein disulfide isomerase family A; member 16; TLP19; ER protein 18; ER protein 19; anterior gradient homolog 1; thioredoxin-like protein p19; endoplasmic reticulum protein ERp19; endoplasmic reticulum resident protein 18; endoplasmic reticulum resident protein 19; protein disulfide isomerase family A, member 16; endoplasmic reticulum thioredoxin superfamily member, 18 kDa; AG1; ERP16; hAG-1; hTLP19; |
Gene ID | 51060 |
mRNA Refseq | NM_015913 |
Protein Refseq | NP_056997 |
MIM | 609448 |
UniProt ID | O95881 |
◆ Recombinant Proteins | ||
Txndc12-6746M | Recombinant Mouse Txndc12 Protein, Myc/DDK-tagged | +Inquiry |
TXNDC12-5037R | Recombinant Rhesus monkey TXNDC12 Protein, His-tagged | +Inquiry |
TXNDC12-1925M | Recombinant Mouse TXNDC12 Protein (25-170 aa), His-tagged | +Inquiry |
TXNDC12-6840H | Recombinant Human Thioredoxin Domain Containing 12 (endoplasmic reticulum), His-tagged | +Inquiry |
TXNDC12-4850R | Recombinant Rhesus Macaque TXNDC12 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TXNDC12-626HCL | Recombinant Human TXNDC12 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TXNDC12 Products
Required fields are marked with *
My Review for All TXNDC12 Products
Required fields are marked with *