Recombinant Human TXNDC17 protein, His-tagged

Cat.No. : TXNDC17-503H
Product Overview : Recombinant Human TXNDC17 protein(NP_116120.1)(1 - 123 aa), fused to His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1 - 123 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
AA Sequence : ARYEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSED
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name TXNDC17 thioredoxin domain containing 17 [ Homo sapiens ]
Official Symbol TXNDC17
Synonyms TRP14; TXNL5
Gene ID 84817
mRNA Refseq NM_032731.3
Protein Refseq NP_116120.1
UniProt ID Q9BRA2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TXNDC17 Products

Required fields are marked with *

My Review for All TXNDC17 Products

Required fields are marked with *

0
cart-icon
0
compare icon