Recombinant Human TXNDC17 protein, His-tagged
| Cat.No. : | TXNDC17-503H |
| Product Overview : | Recombinant Human TXNDC17 protein(NP_116120.1)(1 - 123 aa), fused to His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1 - 123 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
| AA Sequence : | ARYEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSED |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | TXNDC17 thioredoxin domain containing 17 [ Homo sapiens ] |
| Official Symbol | TXNDC17 |
| Synonyms | TRP14; TXNL5 |
| Gene ID | 84817 |
| mRNA Refseq | NM_032731.3 |
| Protein Refseq | NP_116120.1 |
| UniProt ID | Q9BRA2 |
| ◆ Recombinant Proteins | ||
| TXNDC17-2074H | Recombinant Human TXNDC17 protein, His-tagged | +Inquiry |
| TXNDC17-9788M | Recombinant Mouse TXNDC17 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Txndc17-6748M | Recombinant Mouse Txndc17 Protein, Myc/DDK-tagged | +Inquiry |
| TXNDC17-317H | Recombinant Human TXNDC17 protein(Met1-Asp123) | +Inquiry |
| TXNDC17-903Z | Recombinant Zebrafish TXNDC17 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TXNDC17-624HCL | Recombinant Human TXNDC17 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TXNDC17 Products
Required fields are marked with *
My Review for All TXNDC17 Products
Required fields are marked with *
