Recombinant Human TXNDC17 protein, His-tagged
Cat.No. : | TXNDC17-503H |
Product Overview : | Recombinant Human TXNDC17 protein(NP_116120.1)(1 - 123 aa), fused to His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1 - 123 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | ARYEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSED |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | TXNDC17 thioredoxin domain containing 17 [ Homo sapiens ] |
Official Symbol | TXNDC17 |
Synonyms | TRP14; TXNL5 |
Gene ID | 84817 |
mRNA Refseq | NM_032731.3 |
Protein Refseq | NP_116120.1 |
UniProt ID | Q9BRA2 |
◆ Recombinant Proteins | ||
TXNDC17-317H | Recombinant Human TXNDC17 protein(Met1-Asp123) | +Inquiry |
TXNDC17-9788M | Recombinant Mouse TXNDC17 Protein, His (Fc)-Avi-tagged | +Inquiry |
TXNDC17-503H | Recombinant Human TXNDC17 protein, His-tagged | +Inquiry |
TXNDC17-3499H | Recombinant Human TXNDC17, GST-tagged | +Inquiry |
TXNDC17-903Z | Recombinant Zebrafish TXNDC17 | +Inquiry |
◆ Cell & Tissue Lysates | ||
TXNDC17-624HCL | Recombinant Human TXNDC17 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TXNDC17 Products
Required fields are marked with *
My Review for All TXNDC17 Products
Required fields are marked with *