Recombinant Human TYRO3 protein, His-tagged

Cat.No. : TYRO3-3840H
Product Overview : Recombinant Human TYRO3 protein(451-596 aa), fused with N-terminal His tag, was expressed in E. coli.
Availability December 06, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 451-596 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
AA Sequence : LRKRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERPERIEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDSSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRL
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Official Symbol TYRO3
Synonyms TYRO3; TYRO3 protein tyrosine kinase; RSE; tyrosine-protein kinase receptor TYRO3; Brt; Dtk; Sky; Tif; tyrosine-protein kinase DTK; tyrosine-protein kinase RSE; tyrosine-protein kinase SKY; tyrosine-protein kinase byk; BYK; FLJ16467;
Gene ID 7301
mRNA Refseq NM_006293
Protein Refseq NP_006284
MIM 600341
UniProt ID Q06418

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TYRO3 Products

Required fields are marked with *

My Review for All TYRO3 Products

Required fields are marked with *

0
cart-icon
0
compare icon