Recombinant Human TYRO3 protein, His-tagged

• Cat.No.: TYRO3-3840H
• Product Overview: Recombinant Human TYRO3 protein(451-596 aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 451-596 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• AA Sequence: LRKRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERPERIEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDSSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRL
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.

Gene Information

• Official Symbol: TYRO3
• Synonyms: TYRO3; TYRO3 protein tyrosine kinase; RSE; tyrosine-protein kinase receptor TYRO3; Brt; Dtk; Sky; Tif; tyrosine-protein kinase DTK; tyrosine-protein kinase RSE; tyrosine-protein kinase SKY; tyrosine-protein kinase byk; BYK; FLJ16467
• Gene ID: 7301
• mRNA Refseq: NM_006293
• Protein Refseq: NP_006284
• MIM: 600341
• UniProt ID: Q06418