Recombinant Human TYRO3 protein, His-tagged
Cat.No. : | TYRO3-3840H |
Product Overview : | Recombinant Human TYRO3 protein(451-596 aa), fused with N-terminal His tag, was expressed in E. coli. |
Availability | September 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 451-596 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
AA Sequence : | LRKRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERPERIEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDSSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRL |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Official Symbol | TYRO3 |
Synonyms | TYRO3; TYRO3 protein tyrosine kinase; RSE; tyrosine-protein kinase receptor TYRO3; Brt; Dtk; Sky; Tif; tyrosine-protein kinase DTK; tyrosine-protein kinase RSE; tyrosine-protein kinase SKY; tyrosine-protein kinase byk; BYK; FLJ16467; |
Gene ID | 7301 |
mRNA Refseq | NM_006293 |
Protein Refseq | NP_006284 |
MIM | 600341 |
UniProt ID | Q06418 |
◆ Recombinant Proteins | ||
TYRO3-4503H | Recombinant Human TYRO3 Protein, His (Fc)-Avi-tagged | +Inquiry |
TYRO3-195H | Recombinant Human TYRO3 protein, DDK/His-tagged | +Inquiry |
TYRO3-9800M | Recombinant Mouse TYRO3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Tyro3-9799M | Recombinant Mouse Tyro3 Protein, His (Fc)-Avi-tagged | +Inquiry |
TYRO3-3847H | Recombinant Human TYRO3 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TYRO3-615HCL | Recombinant Human TYRO3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TYRO3 Products
Required fields are marked with *
My Review for All TYRO3 Products
Required fields are marked with *