Recombinant Human TYRO3 protein, His-tagged
| Cat.No. : | TYRO3-3840H |
| Product Overview : | Recombinant Human TYRO3 protein(451-596 aa), fused with N-terminal His tag, was expressed in E. coli. |
| Availability | February 05, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 451-596 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| AA Sequence : | LRKRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERPERIEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDSSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRL |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Official Symbol | TYRO3 |
| Synonyms | TYRO3; TYRO3 protein tyrosine kinase; RSE; tyrosine-protein kinase receptor TYRO3; Brt; Dtk; Sky; Tif; tyrosine-protein kinase DTK; tyrosine-protein kinase RSE; tyrosine-protein kinase SKY; tyrosine-protein kinase byk; BYK; FLJ16467; |
| Gene ID | 7301 |
| mRNA Refseq | NM_006293 |
| Protein Refseq | NP_006284 |
| MIM | 600341 |
| UniProt ID | Q06418 |
| ◆ Recombinant Proteins | ||
| Tyro3-896M | Recombinant Mouse Tyro3 protein, His-tagged | +Inquiry |
| Tyro3-18M | Recombinant Mouse Tyro3 Protein, Fc-tagged | +Inquiry |
| TYRO3-0781H | Recombinant Human TYRO3 protein, Fc-tagged | +Inquiry |
| TYRO3-026H | Recombinant Human TYRO3 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
| TYRO3-6195C | Recombinant Chicken TYRO3 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TYRO3-615HCL | Recombinant Human TYRO3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TYRO3 Products
Required fields are marked with *
My Review for All TYRO3 Products
Required fields are marked with *
