Recombinant Human TYROBP Protein, SUMO&His-tagged

• Cat.No.: TYROBP-520H
• Product Overview: Recombinant Human TYROBP Protein(O43914)(Gly71-Pro110), fused with N-terminal SUMO tag and C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: Gly71-Pro110
• Form: Phosphate buffered saline
• Storage: Store at -20 to -80°C.
• Molecular Mass: 18 kDa
• AA Sequence: GRGAAEAATRKQRITETESPYQELQGQRSDVYSDLNTQRP

Gene Information

• Official Symbol: TYROBP
• Synonyms: TYROBP; TYRO protein tyrosine kinase binding protein; PLOSL; TYRO protein tyrosine kinase-binding protein; DAP12; DNAX activation protein 12; KARAP; killer activating receptor associated protein; PLO SL; KAR-associated protein; DNAX-activation protein 12; killer-activating receptor-associated protein
• Gene ID: 7305
• mRNA Refseq: NM_198125
• Protein Refseq: NP_937758
• MIM: 604142
• UniProt ID: O43914