Recombinant Human TYROBP Protein, SUMO&His-tagged
| Cat.No. : | TYROBP-520H |
| Product Overview : | Recombinant Human TYROBP Protein(O43914)(Gly71-Pro110), fused with N-terminal SUMO tag and C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | Gly71-Pro110 |
| Form : | Phosphate buffered saline |
| Storage : | Store at -20 to -80°C. |
| Molecular Mass : | 18 kDa |
| AA Sequence : | GRGAAEAATRKQRITETESPYQELQGQRSDVYSDLNTQRP |
| Official Symbol | TYROBP |
| Synonyms | TYROBP; TYRO protein tyrosine kinase binding protein; PLOSL; TYRO protein tyrosine kinase-binding protein; DAP12; DNAX activation protein 12; KARAP; killer activating receptor associated protein; PLO SL; KAR-associated protein; DNAX-activation protein 12; killer-activating receptor-associated protein; |
| Gene ID | 7305 |
| mRNA Refseq | NM_198125 |
| Protein Refseq | NP_937758 |
| MIM | 604142 |
| UniProt ID | O43914 |
| ◆ Cell & Tissue Lysates | ||
| TYROBP-614HCL | Recombinant Human TYROBP 293 Cell Lysate | +Inquiry |
| TYROBP-613HCL | Recombinant Human TYROBP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TYROBP Products
Required fields are marked with *
My Review for All TYROBP Products
Required fields are marked with *
