Recombinant Human UBE2D3, His-tagged

Cat.No. : UBE2D3-30044TH
Product Overview : Recombinant full length Human UBE2D3, isoform 3 with an N terminal His tag mwt: 19.1 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 149 amino acids
Description : The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme functions in the ubiquitination of the tumor-suppressor protein p53, which is induced by an E3 ubiquitin-protein ligase. Multiple spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been determined.
Conjugation : HIS
Molecular Weight : 19.100kDa inclusive of tags
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : pH: 8.00Constituents:0.32% Tris HCl, 40% Glycerol, 0.88% Sodium chloride, 0.02% DTT
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMLSNRKCLSKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM
Sequence Similarities : Belongs to the ubiquitin-conjugating enzyme family.
Gene Name UBE2D3 ubiquitin-conjugating enzyme E2D 3 [ Homo sapiens ]
Official Symbol UBE2D3
Synonyms UBE2D3; ubiquitin-conjugating enzyme E2D 3; ubiquitin conjugating enzyme E2D 3 (homologous to yeast UBC4/5) , ubiquitin conjugating enzyme E2D 3 (UBC4/5 homolog, yeast); ubiquitin-conjugating enzyme E2 D3; UbcH5C;
Gene ID 7323
mRNA Refseq NM_003340
Protein Refseq NP_003331
MIM 602963
Uniprot ID P61077
Chromosome Location 4q24
Pathway Adaptive Immune System, organism-specific biosystem; Antigen processing: Ubiquitination & Proteasome degradation, organism-specific biosystem; BARD1 signaling events, organism-specific biosystem; Canonical NF-kappaB pathway, organism-specific biosystem;
Function ATP binding; acid-amino acid ligase activity; ligase activity; nucleotide binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All UBE2D3 Products

Required fields are marked with *

My Review for All UBE2D3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon