Recombinant Human UBE2D3, His-tagged
| Cat.No. : | UBE2D3-30044TH |
| Product Overview : | Recombinant full length Human UBE2D3, isoform 3 with an N terminal His tag mwt: 19.1 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 149 amino acids |
| Description : | The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme functions in the ubiquitination of the tumor-suppressor protein p53, which is induced by an E3 ubiquitin-protein ligase. Multiple spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been determined. |
| Conjugation : | HIS |
| Molecular Weight : | 19.100kDa inclusive of tags |
| Form : | Liquid |
| Purity : | >90% by SDS-PAGE |
| Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 40% Glycerol, 0.88% Sodium chloride, 0.02% DTT |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMLSNRKCLSKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM |
| Sequence Similarities : | Belongs to the ubiquitin-conjugating enzyme family. |
| Gene Name | UBE2D3 ubiquitin-conjugating enzyme E2D 3 [ Homo sapiens ] |
| Official Symbol | UBE2D3 |
| Synonyms | UBE2D3; ubiquitin-conjugating enzyme E2D 3; ubiquitin conjugating enzyme E2D 3 (homologous to yeast UBC4/5) , ubiquitin conjugating enzyme E2D 3 (UBC4/5 homolog, yeast); ubiquitin-conjugating enzyme E2 D3; UbcH5C; |
| Gene ID | 7323 |
| mRNA Refseq | NM_003340 |
| Protein Refseq | NP_003331 |
| MIM | 602963 |
| Uniprot ID | P61077 |
| Chromosome Location | 4q24 |
| Pathway | Adaptive Immune System, organism-specific biosystem; Antigen processing: Ubiquitination & Proteasome degradation, organism-specific biosystem; BARD1 signaling events, organism-specific biosystem; Canonical NF-kappaB pathway, organism-specific biosystem; |
| Function | ATP binding; acid-amino acid ligase activity; ligase activity; nucleotide binding; protein binding; |
| ◆ Recombinant Proteins | ||
| UBE2D3-17710M | Recombinant Mouse UBE2D3 Protein | +Inquiry |
| UBE2D3-2004H | Recombinant Human UBE2D3 Protein, His-tagged | +Inquiry |
| UBE2D3-3643H | Recombinant Human UBE2D3 protein, His-SUMO-tagged | +Inquiry |
| UBE2D3-004H | Recombinant Human UBE2D3 protein | +Inquiry |
| UBE2D3-5130H | Recombinant Human UBE2D3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| UBE2D3-586HCL | Recombinant Human UBE2D3 293 Cell Lysate | +Inquiry |
| UBE2D3-585HCL | Recombinant Human UBE2D3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UBE2D3 Products
Required fields are marked with *
My Review for All UBE2D3 Products
Required fields are marked with *



