Recombinant Human UBE2V2 protein, His-SUMO-tagged

Cat.No. : UBE2V2-3644H
Product Overview : Recombinant Human UBE2V2 protein(Q15819)(2-145aa), fused to N-terminal His-SUMO tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 2-145aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 32.2 kDa
AA Sequence : AVSTGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTYNN
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name UBE2V2 ubiquitin-conjugating enzyme E2 variant 2 [ Homo sapiens ]
Official Symbol UBE2V2
Synonyms UBE2V2; ubiquitin-conjugating enzyme E2 variant 2; DDVit 1; EDPF 1; MMS2; UEV 2; MMS2 homolog; vitamin D3-inducible protein; 1 alpha,25-dihydroxyvitamin D3-inducible; enterocyte differentiation promoting factor; enterocyte differentiation-promoting factor 1; enterocyte differentiation-associated factor 1; enterocyte differentiation-associated factor EDAF-1; methyl methanesulfonate sensitive 2, S. cerevisiae, homolog of; UEV2; EDPF1; UEV-2; DDVIT1; EDAF-1; EDPF-1; DDVit-1;
Gene ID 7336
mRNA Refseq NM_003350
Protein Refseq NP_003341
MIM 603001
UniProt ID Q15819

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All UBE2V2 Products

Required fields are marked with *

My Review for All UBE2V2 Products

Required fields are marked with *

0
cart-icon
0
compare icon