Recombinant Human UBE2V2 protein, His-SUMO-tagged
Cat.No. : | UBE2V2-3644H |
Product Overview : | Recombinant Human UBE2V2 protein(Q15819)(2-145aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 2-145aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 32.2 kDa |
AA Sequence : | AVSTGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTYNN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | UBE2V2 ubiquitin-conjugating enzyme E2 variant 2 [ Homo sapiens ] |
Official Symbol | UBE2V2 |
Synonyms | UBE2V2; ubiquitin-conjugating enzyme E2 variant 2; DDVit 1; EDPF 1; MMS2; UEV 2; MMS2 homolog; vitamin D3-inducible protein; 1 alpha,25-dihydroxyvitamin D3-inducible; enterocyte differentiation promoting factor; enterocyte differentiation-promoting factor 1; enterocyte differentiation-associated factor 1; enterocyte differentiation-associated factor EDAF-1; methyl methanesulfonate sensitive 2, S. cerevisiae, homolog of; UEV2; EDPF1; UEV-2; DDVIT1; EDAF-1; EDPF-1; DDVit-1; |
Gene ID | 7336 |
mRNA Refseq | NM_003350 |
Protein Refseq | NP_003341 |
MIM | 603001 |
UniProt ID | Q15819 |
◆ Recombinant Proteins | ||
UBE2V2-0522H | Recombinant Human UBE2V2 Protein (A2-N145), His/Strep tagged | +Inquiry |
UBE2V2-30036TH | Recombinant Human UBE2V2, His-tagged | +Inquiry |
UBE2V2-4882R | Recombinant Rhesus Macaque UBE2V2 Protein, His (Fc)-Avi-tagged | +Inquiry |
UBE2V2-60H | Recombinant Human UBE2V2, His-tagged | +Inquiry |
UBE2V2-3644H | Recombinant Human UBE2V2 protein, His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
UBE2V2-559HCL | Recombinant Human UBE2V2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UBE2V2 Products
Required fields are marked with *
My Review for All UBE2V2 Products
Required fields are marked with *