Recombinant Human Ubiquitin-Conjugating Enzyme E2L 3, His-tagged
Cat.No. : | UBE2L3-1499H |
Product Overview : | Ubiquitin-Conjugating Enzyme E2L 3 Human Recombinant produced in E.coli is an 18.9 kDa protein containing 162 amino acids. The UBE2L3 protein contains 6xHis tag and is purified by proprietary chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human |
Tag : | His |
Description : | Human Ubquitin Conjugating Enzyme 7 (UbcH7) is a class I enzyme which functions in the stress response and the control of transcription factors. The enzyme is ubiquitously expressed with high levels of expression seen in adult muscle. UbcH7 mediates the selective degradation of short-lived and abnormal proteins and is highly homologous to UbcH5. It has been demonstrated to participate in the ubiquitinylation of p53, c-Fos. UbcH7 is one of two E2s (UbcH5 being the other) with which HECT domain proteins interact with UbcH7 being able to efficiently substitute for UbcH5 in E6-AP-dependent ubiquitinylation. |
Form : | Lyophilized from a 0.2 μm filtered concentrated (1 mg/ml) solution in 1X PBS and 1 mM DTT, pH 7.5. |
Purity : | Greater than 95.0% as determined by (a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
Physical Appearance : | Sterile Filtered white lyophilized powder. |
Solubility : | It is recommended to reconstitute the lyophilized UBE2L3 in sterile water not less than 100 µg/ml, which can then be further diluted to other aqueous solutions. |
Amino acid sequence : | MHHHHHHAMAASRRLMKELEEIRKCGMKNFRNIQVDEANLLTWQGLIVP DNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAEN WKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFT KKYGEKRPVD. |
Storage : | Lyophilized UBE2L3 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution UBE2L3 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles. |
Gene Name | UBE2L3 ubiquitin-conjugating enzyme E2L 3 [ Homo sapiens ] |
Official Symbol | UBE2L3 |
Synonyms | UBE2L3; ubiquitin-conjugating enzyme E2L 3; E2-F1; L-UBC; UBCH7; UbcM4; ubiquitin-conjugating enzyme E2 L3; OTTHUMP00000198565; ubiquitin-protein ligase L3; ubiquitin carrier protein L3; ubiquitin-conjugating enzyme E2-F1; ubiquitin-conjugating enzyme UBCH7 |
Gene ID | 7332 |
mRNA Refseq | NM_003347 |
Protein Refseq | NP_003338 |
MIM | 603721 |
UniProt ID | P68036 |
Chromosome Location | 22q11.21 |
Pathway | Adaptive Immunity Signaling; Alpha-synuclein; Antigen processing; BARD1 signaling events; Class I MHC mediated antigen processing & presentation; Immune System; Parkinson"s disease; Ubiquitin mediated proteolysis |
Function | ATP binding; acid-amino acid ligase activity; enzyme binding; ligase activity; nucleotide binding; protein binding; transcription coactivator activity; ubiquitin protein ligase binding; ubiquitin-protein ligase activity |
◆ Recombinant Proteins | ||
UBE2L3-23HFL | Recombinant Full Length Human UBE2L3 Protein, GST tagged | +Inquiry |
UBE2L3-02H | Recombinant Full Length Human UBE2L3 protein, N-His-tagged | +Inquiry |
UBE2L3-3538H | Recombinant Full Length Human UBE2L3, GST-tagged | +Inquiry |
UBE2L3-2296H | Recombinant Human UBE2L3 Protein, His (Fc)-Avi-tagged | +Inquiry |
UBE2L3-1499H | Recombinant Human Ubiquitin-Conjugating Enzyme E2L 3, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
UBE2L3-570HCL | Recombinant Human UBE2L3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UBE2L3 Products
Required fields are marked with *
My Review for All UBE2L3 Products
Required fields are marked with *