Recombinant Human UBL4B protein, GST-tagged
Cat.No. : | UBL4B-3553H |
Product Overview : | Recombinant Human UBL4B protein(1-174 aa), fused with N-terminal GST tag, was expressed in E. coli. |
Availability | July 07, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-174 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
AA Sequence : | MFLTVKLLLGQRCSLKVSGQESVATLKRLVSRRLKVPEEQQHLLFRGQLLEDDKHLSDYCIGPNASINVIMQPLEKMALKEAHQPQTQPLWHQLGLVLAKHFEPQDAKAVLQLLRQEHEERLQKISLEHLEQLAQYLLAEEPHVEPAGERELEAKARPQSSCDMEEKEEAAADQ |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Official Symbol | UBL4B |
Synonyms | UBL4B; ubiquitin-like 4B; ubiquitin-like protein 4B; FLJ25690; |
Gene ID | 164153 |
mRNA Refseq | NM_203412 |
Protein Refseq | NP_981957 |
MIM | 611127 |
UniProt ID | Q8N7F7 |
◆ Recombinant Proteins | ||
UBL4B-3553H | Recombinant Human UBL4B protein, GST-tagged | +Inquiry |
UBL4B-3340H | Recombinant Human UBL4B protein, His-tagged | +Inquiry |
UBL4B-9849M | Recombinant Mouse UBL4B Protein, His (Fc)-Avi-tagged | +Inquiry |
UBL4B-17747M | Recombinant Mouse UBL4B Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
UBL4B-1875HCL | Recombinant Human UBL4B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UBL4B Products
Required fields are marked with *
My Review for All UBL4B Products
Required fields are marked with *