Recombinant Human UBXN11 protein, GST-tagged
| Cat.No. : | UBXN11-3566H |
| Product Overview : | Recombinant Human UBXN11 protein(1-324 aa), fused with N-terminal GST tag, was expressed in E. coli. |
| Availability | July 15, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E. coli |
| Tag : | GST |
| Protein Length : | 1-324 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | MSSPLASLSKTRKVPLPSEPMNPGRRGIRIYGDEDEVDMLSDGCGSEEKISVPSCYGGIGAPVSRQVPASHDSELMAFMTRKLWDLEQQVKAQTDEILSKDQKIAALEDLVQTLRPHPAEATLQRQEELETMCVQLQRQVREMERFLSDYGLQWVGEPMDQEDSESKTVSEHGERDWMTAKKFWKPGDSLAPPEVDFDRLLASLQDLSELVVEGDTQVTPVPGGARLRTLEPIPLKLYRNGIMMFDGPFQPFYDPSTQRCLRDILDGFFPSELQRLYPNGVPFKVISCSSNHTFGDFEGSGDTQPPQTPPILRGSRCTPWGTPV |
| Purity : | 90%, by SDS-PAGE. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name | UBXN11 UBX domain protein 11 [ Homo sapiens ] |
| Official Symbol | UBXN11 |
| Synonyms | UBXN11; UBX domain protein 11; UBX domain containing 5 , UBXD5; UBX domain-containing protein 11; SOC; SOCI; socius; UBX domain-containing protein 5; colorectal tumor-associated antigen-1; colorectal tumor-associated antigen COA-1; COA-1; UBXD5; PP2243; DKFZp686F04228; |
| mRNA Refseq | NM_001077262 |
| Protein Refseq | NP_001070730 |
| MIM | 609151 |
| UniProt ID | Q5T124 |
| Gene ID | 91544 |
| ◆ Recombinant Proteins | ||
| UBXN11-2552H | Recombinant Human UBXN11 protein, His-tagged | +Inquiry |
| UBXN11-6071R | Recombinant Rat UBXN11 Protein, His (Fc)-Avi-tagged | +Inquiry |
| UBXN11-6415R | Recombinant Rat UBXN11 Protein | +Inquiry |
| UBXN11-31555TH | Recombinant Human UBXN11, His-tagged | +Inquiry |
| UBXN11-3566H | Recombinant Human UBXN11 protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UBXN11 Products
Required fields are marked with *
My Review for All UBXN11 Products
Required fields are marked with *




