Recombinant Human UBXN11 protein, GST-tagged

Cat.No. : UBXN11-3566H
Product Overview : Recombinant Human UBXN11 protein(1-324 aa), fused with N-terminal GST tag, was expressed in E. coli.
Availability June 18, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E. coli
Tag : GST
Protein Length : 1-324 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
AASequence : MSSPLASLSKTRKVPLPSEPMNPGRRGIRIYGDEDEVDMLSDGCGSEEKISVPSCYGGIGAPVSRQVPASHDSELMAFMTRKLWDLEQQVKAQTDEILSKDQKIAALEDLVQTLRPHPAEATLQRQEELETMCVQLQRQVREMERFLSDYGLQWVGEPMDQEDSESKTVSEHGERDWMTAKKFWKPGDSLAPPEVDFDRLLASLQDLSELVVEGDTQVTPVPGGARLRTLEPIPLKLYRNGIMMFDGPFQPFYDPSTQRCLRDILDGFFPSELQRLYPNGVPFKVISCSSNHTFGDFEGSGDTQPPQTPPILRGSRCTPWGTPV
Purity : 90%, by SDS-PAGE.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
Gene Name UBXN11 UBX domain protein 11 [ Homo sapiens ]
Official Symbol UBXN11
Synonyms UBXN11; UBX domain protein 11; UBX domain containing 5 , UBXD5; UBX domain-containing protein 11; SOC; SOCI; socius; UBX domain-containing protein 5; colorectal tumor-associated antigen-1; colorectal tumor-associated antigen COA-1; COA-1; UBXD5; PP2243; DKFZp686F04228;
mRNA Refseq NM_001077262
Protein Refseq NP_001070730
MIM 609151
UniProt ID Q5T124
Gene ID 91544

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All UBXN11 Products

Required fields are marked with *

My Review for All UBXN11 Products

Required fields are marked with *

0
cart-icon
0
compare icon