Recombinant Human UBXN11 protein, His-tagged
Cat.No. : | UBXN11-2552H |
Product Overview : | Recombinant Human UBXN11 protein(1-324 aa), fused with N-terminal His tag, was expressed in E. coli. |
Availability | July 05, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | His |
Protein Length : | 1-324 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | MSSPLASLSKTRKVPLPSEPMNPGRRGIRIYGDEDEVDMLSDGCGSEEKISVPSCYGGIGAPVSRQVPASHDSELMAFMTRKLWDLEQQVKAQTDEILSKDQKIAALEDLVQTLRPHPAEATLQRQEELETMCVQLQRQVREMERFLSDYGLQWVGEPMDQEDSESKTVSEHGERDWMTAKKFWKPGDSLAPPEVDFDRLLASLQDLSELVVEGDTQVTPVPGGARLRTLEPIPLKLYRNGIMMFDGPFQPFYDPSTQRCLRDILDGFFPSELQRLYPNGVPFKVISCSSNHTFGDFEGSGDTQPPQTPPILRGSRCTPWGTPV |
Purity : | 85%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | UBXN11 UBX domain protein 11 [ Homo sapiens ] |
Official Symbol | UBXN11 |
Synonyms | UBXN11; UBX domain protein 11; UBX domain containing 5 , UBXD5; UBX domain-containing protein 11; SOC; SOCI; socius; UBX domain-containing protein 5; colorectal tumor-associated antigen-1; colorectal tumor-associated antigen COA-1; COA-1; UBXD5; PP2243; DKFZp686F04228; |
mRNA Refseq | NM_001077262 |
Protein Refseq | NP_001070730 |
MIM | 609151 |
UniProt ID | Q5T124 |
Gene ID | 91544 |
◆ Recombinant Proteins | ||
UBXN11-6415R | Recombinant Rat UBXN11 Protein | +Inquiry |
UBXN11-17771M | Recombinant Mouse UBXN11 Protein | +Inquiry |
UBXN11-6071R | Recombinant Rat UBXN11 Protein, His (Fc)-Avi-tagged | +Inquiry |
UBXN11-31555TH | Recombinant Human UBXN11, His-tagged | +Inquiry |
UBXN11-5302H | Recombinant Human UBXN11 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UBXN11 Products
Required fields are marked with *
My Review for All UBXN11 Products
Required fields are marked with *