Recombinant Human UCHL1 protein(111-210 aa), C-His-tagged

Cat.No. : UCHL1-2620H
Product Overview : Recombinant Human UCHL1 protein(P09936)(111-210 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 111-210 aa
Form : 0.15 M Phosphate buffered saline
Molecular Mass : 14 kDa
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : GSVLKQFLSETEKMSPEDRAKCFEKNEAIQAAHDAVAQEGQCRVDDKVNFHFILFNNVDGHLYELDGRMPFPVNHGASSEDTLLKDAAKVCREFTEREQG
Gene Name UCHL1 ubiquitin carboxyl-terminal esterase L1 (ubiquitin thiolesterase) [ Homo sapiens ]
Official Symbol UCHL1
Synonyms UCHL1; ubiquitin carboxyl-terminal esterase L1 (ubiquitin thiolesterase); PARK5; ubiquitin carboxyl-terminal hydrolase isozyme L1; PGP9.5; Uch L1; ubiquitin thioesterase L1; neuron cytoplasmic protein 9.5; ubiquitin C-terminal hydrolase; PGP95; Uch-L1; PGP 9.5;
Gene ID 7345
mRNA Refseq NM_004181
Protein Refseq NP_004172
MIM 191342
UniProt ID P09936

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All UCHL1 Products

Required fields are marked with *

My Review for All UCHL1 Products

Required fields are marked with *

0
cart-icon