"UCP1" Related Products

Expand
Expand
Expand

Recombinant Human UCP1 Protein (2-307 aa), His-tagged

Cat.No.: UCP1-1552H
Product Overview: Recombinant Human UCP1 Protein (2-307 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Transport. Protein Description: Full Length of Mature Protein.
Description: UCP are mitochondrial transporter proteins that create proton leaks across the inner mitochondrial mbrane, thus uncoupling oxidative phosphorylation from ATP synthesis. As a result, energy is dissipated in the form of heat.
Source: Yeast
Species: Human
Tag : His
Form: Tris-based buffer,50% glycerol
Molecular Mass: 34.9 kDa
Protein length: 2-307 aa
AA Sequence: GGLTASDVHPTLGVQLFSAGIAACLADVITFPLDTAKVRLQVQGECPTSSVIRYKGVLGTITAVVKTEGRMKLYSGLPAGLQRQISSASLRIGLYDTVQEFLTAGKETAPSLGSKILAGLTTGGVAVFIGQPTEVVKVRLQAQSHLHGIKPRYTGTYNAYRIIATTEGLTGLWKGTTPNLMRSVIINCTELVTYDLMKEAFVKNNILADDVPCHLVSALIAGFCATAMSSPVDVVKTRFINSPPGQYKSVPNCAMKVFTNEGPTAFFKGLVPSFLRLGSWNVIMFVCFEQLKRELSKSRQTMDCAT
Purity: > 90% as determined by SDS-PAGE.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name: UCP1 uncoupling protein 1 (mitochondrial, proton carrier) [ Homo sapiens ]
Official Symbol: UCP1
Synonyms: UCP1; UCP; SLC25A7; thermogenin; solute carrier family 25 member 7;
Gene ID: 7350
mRNA Refseq: NM_021833
Protein Refseq: NP_068605
MIM: 113730
UniProt ID: P25874

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.