Recombinant Human UCP1 Protein (2-307 aa), His-tagged

• Cat.No.: UCP1-1552H
• Product Overview: Recombinant Human UCP1 Protein (2-307 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Transport. Protein Description: Full Length of Mature Protein.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• Protein Length: 2-307 aa
• Description: UCP are mitochondrial transporter proteins that create proton leaks across the inner mitochondrial mbrane, thus uncoupling oxidative phosphorylation from ATP synthesis. As a result, energy is dissipated in the form of heat.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 34.9 kDa
• AA Sequence: GGLTASDVHPTLGVQLFSAGIAACLADVITFPLDTAKVRLQVQGECPTSSVIRYKGVLGTITAVVKTEGRMKLYSGLPAGLQRQISSASLRIGLYDTVQEFLTAGKETAPSLGSKILAGLTTGGVAVFIGQPTEVVKVRLQAQSHLHGIKPRYTGTYNAYRIIATTEGLTGLWKGTTPNLMRSVIINCTELVTYDLMKEAFVKNNILADDVPCHLVSALIAGFCATAMSSPVDVVKTRFINSPPGQYKSVPNCAMKVFTNEGPTAFFKGLVPSFLRLGSWNVIMFVCFEQLKRELSKSRQTMDCAT
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: UCP1 uncoupling protein 1 (mitochondrial, proton carrier) [ Homo sapiens ]
• Official Symbol: UCP1
• Synonyms: UCP1; UCP; SLC25A7; thermogenin; solute carrier family 25 member 7
• Gene ID: 7350
• mRNA Refseq: NM_021833
• Protein Refseq: NP_068605
• MIM: 113730
• UniProt ID: P25874