Recombinant Human UGT1A3

Cat.No. : UGT1A3-207H
Product Overview : Recombinant Human UGT1A3, fused without tag, was expressed in wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Description : This gene encodes a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases. The locus includes thirteen unique alternate first exons followed by four common exons. Four of the alternate first exons are considered pseudogenes. Each of the remaining nine 5' exons may be spliced to the four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodes the substrate binding site, and is regulated by its own promoter. Substrates of this enzyme include estrone, 2-hydroxyestrone, and metabolites of benzo alpha-pyrene.
Form : Liquid
Molecular Mass : 58.8 kDa
AA Sequence : MATGLQVPLPWLATGLLLLLSVQPWAESGKVLVVPIDGSHWLSMREVLRELHARGHQAVVLTPEVNMHIKEENFF TLTTYAISWTQDEFDRHVLGHTQLYFETEHFLKKFFRSMAMLNNMSLVYHRSCVELLHNEALIRHLNATSFDVVL TDPVNLCAAVLAKYLSIPTVFFLRNIPCDLDFKGTQCPNPSSYIPRLLTTNSDHMTFMQRVKNMLYPLALSYICH AFSAPYASLASELFQREVSVVDILSHASVWLFRGDFVMDYPRPIMPNMVFIGGINCANRKPLSQEFEAYINASGE HGIVVFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVKWLPQNDLLGHPMTRAFITHAG SHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTSEDLENALKAVINDKSYKENIMRLSSLHKD RPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTWYQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRV KKAHKSKTH
Applications : Antibody Production; Functional Study; Compound Screening
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene Name UGT1A3 UDP glucuronosyltransferase 1 family, polypeptide A3 [ Homo sapiens (human) ]
Official Symbol UGT1A3
Synonyms UDP glucuronosyltransferase 1 family, polypeptide A3; UDPGT 1-3; UGT1C; EC 2.4.1.17; UDP glycosyltransferase 1 family, polypeptide A3; OTTHUMP00000065199; UGT-1C; UDPGT; UGT1*3; UDP glucuronosyltransferase 1A3; UGT1-03; UDP-glucuronosyltransferase 1-3; UGT1.3; GNT1; UDP-glucuronosyltransferase 1-C; UGT1; UDP-glucuronosyltransferase 1A3; OTTHUMP00000065193
Gene ID 54659
mRNA Refseq NM_019093
Protein Refseq NP_061966
MIM 606428
UniProt ID Q5DT01
Chromosome Location 2q37
Pathway Ascorbate and aldarate metabolism; Drug metabolism - cytochrome P450; Metabolic pathways
Function enzyme binding; glucuronosyltransferase activity; protein heterodimerization activity

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All UGT1A3 Products

Required fields are marked with *

My Review for All UGT1A3 Products

Required fields are marked with *

0
cart-icon