Recombinant Human UHMK1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: UHMK1-5049H
• Product Overview: UHMK1 MS Standard C13 and N15-labeled recombinant protein (NP_787062) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: The gene encodes a serine/threonine protein kinase that promotes cell cycle progression through G1 by phosphorylation of the cyclin-dependent kinase inhibitor 1B (p27Kip1), which causes nuclear export and degradation. The encoded protein is also thought to function in the adult nervous system and the gene has been associated with schizophrenia. Alternative splicing results in multiple transcript variants.
• Molecular Mass: 46.4 kDa
• AA Sequence: MAGSGCAWGAEPPRFLEAFGRLWQVQSRLGSGSSASVYRVRCCGNPGSPPGALKQFLPPGTTGAAASAAEYGFRKERAALEQLQGHRNIVTLYGVFTIHFSPNVPSRCLLLELLDVSVSELLLYSSHQGCSMWMIQHCARDVLEALAFLHHEGYVHADLKPRNILWSAENECFKLIDFGLSFKEGNQDVKYIQTDGYRAPEAELQNCLAQAGLQSDTECTSAVDLWSLGIILLEMFSGMKLKHTVRSQEWKANSSAIIDHIFASKAVVNAAIPAYHLRDLIKSMLHDDPSRRIPAEMALCSPFFSIPFAPHIEDLVMLPTPVLRLLNVLDDDYLENEEEYEDVVEDVKEECQKYGPVVSLLVPKENPGRGQVFVEYANAGDSKAAQKLLTGRMFDGKFVVATFYPLSAYKRGYLYQTLLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: UHMK1 U2AF homology motif kinase 1 [ Homo sapiens (human) ]
• Official Symbol: UHMK1
• Synonyms: UHMK1; U2AF homology motif (UHM) kinase 1; serine/threonine-protein kinase Kist; KIS; Kist; KIS protein kinase; kinase interacting with leukemia-associated gene (stathmin); KIST; FLJ23015; DKFZp434C1613
• Gene ID: 127933
• mRNA Refseq: NM_175866
• Protein Refseq: NP_787062
• MIM: 608849
• UniProt ID: Q8TAS1