Recombinant Human UHMK1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : UHMK1-5049H
Product Overview : UHMK1 MS Standard C13 and N15-labeled recombinant protein (NP_787062) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The gene encodes a serine/threonine protein kinase that promotes cell cycle progression through G1 by phosphorylation of the cyclin-dependent kinase inhibitor 1B (p27Kip1), which causes nuclear export and degradation. The encoded protein is also thought to function in the adult nervous system and the gene has been associated with schizophrenia. Alternative splicing results in multiple transcript variants.
Molecular Mass : 46.4 kDa
AA Sequence : MAGSGCAWGAEPPRFLEAFGRLWQVQSRLGSGSSASVYRVRCCGNPGSPPGALKQFLPPGTTGAAASAAEYGFRKERAALEQLQGHRNIVTLYGVFTIHFSPNVPSRCLLLELLDVSVSELLLYSSHQGCSMWMIQHCARDVLEALAFLHHEGYVHADLKPRNILWSAENECFKLIDFGLSFKEGNQDVKYIQTDGYRAPEAELQNCLAQAGLQSDTECTSAVDLWSLGIILLEMFSGMKLKHTVRSQEWKANSSAIIDHIFASKAVVNAAIPAYHLRDLIKSMLHDDPSRRIPAEMALCSPFFSIPFAPHIEDLVMLPTPVLRLLNVLDDDYLENEEEYEDVVEDVKEECQKYGPVVSLLVPKENPGRGQVFVEYANAGDSKAAQKLLTGRMFDGKFVVATFYPLSAYKRGYLYQTLLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name UHMK1 U2AF homology motif kinase 1 [ Homo sapiens (human) ]
Official Symbol UHMK1
Synonyms UHMK1; U2AF homology motif (UHM) kinase 1; serine/threonine-protein kinase Kist; KIS; Kist; KIS protein kinase; kinase interacting with leukemia-associated gene (stathmin); KIST; FLJ23015; DKFZp434C1613;
Gene ID 127933
mRNA Refseq NM_175866
Protein Refseq NP_787062
MIM 608849
UniProt ID Q8TAS1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All UHMK1 Products

Required fields are marked with *

My Review for All UHMK1 Products

Required fields are marked with *

0
cart-icon
0
compare icon