Recombinant Human ULBP1 protein, His-tagged
| Cat.No. : | ULBP1-3378H |
| Product Overview : | Recombinant Human ULBP1 protein(26-103 aa), fused to His tag, was expressed in E. coli. |
| Availability | July 02, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 26-103 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | GWVDTHCLCYDFIITPKSRPEPQWCEVQGLVDERPFLHYDCVNHKAKAFASLGKKVNVTKTWEEQTETLRDVVDFLKG |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | ULBP1 UL16 binding protein 1 [ Homo sapiens ] |
| Official Symbol | ULBP1 |
| Synonyms | ULBP1; UL16 binding protein 1; NKG2D ligand 1; RAET1I; N2DL-1; NKG2DL1; alcan-beta; UL16-binding protein 1; retinoic acid early transcript 1I; |
| Gene ID | 80329 |
| mRNA Refseq | NM_025218 |
| Protein Refseq | NP_079494 |
| MIM | 605697 |
| UniProt ID | Q9BZM6 |
| ◆ Recombinant Proteins | ||
| ULBP1-3378H | Recombinant Human ULBP1 protein, His-tagged | +Inquiry |
| ULBP1-3591H | Recombinant Human ULBP1, His-tagged | +Inquiry |
| ULBP1-3249HA | Recombinant Human ULBP1 protein, Fc-His-tagged, APC labeled | +Inquiry |
| ULBP1-270H | Recombinant Human UL16 binding protein 1 Protein, His tagged | +Inquiry |
| ULBP1-3249HAF488 | Recombinant Human ULBP1 Protein, Fc/His-tagged, Alexa Fluor 488 conjugated | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ULBP1-2440HCL | Recombinant Human ULBP1 cell lysate | +Inquiry |
| ULBP1-2641HCL | Recombinant Human ULBP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ULBP1 Products
Required fields are marked with *
My Review for All ULBP1 Products
Required fields are marked with *
