| Species : | 
                                    Human | 
                                
                                
                                    | Source : | 
                                    HEK293 | 
                                
                                
                                    | Tag : | 
                                    DDK&Myc | 
                                
                                
                                    | Description : | 
                                    This gene encodes a uridine 5'-monophosphate synthase. The encoded protein is a bifunctional enzyme that catalyzes the final two steps of the de novo pyrimidine biosynthetic pathway. The first reaction is carried out by the N-terminal enzyme orotate phosphoribosyltransferase which converts orotic acid to orotidine-5'-monophosphate. The terminal reaction is carried out by the C-terminal enzyme OMP decarboxylase which converts orotidine-5'-monophosphate to uridine monophosphate. Defects in this gene are the cause of hereditary orotic aciduria. Alternate splicing results in multiple transcript variants. | 
                                
                                
                                    | Molecular Mass : | 
                                    52.2 kDa | 
                                
                                
                                    | AA Sequence : | 
                                    MAVARAALGPLVTGLYDVQAFKFGDFVLKSGLSSPIYIDLRGIVSRPRLLSQVADILFQTAQNAGISFDTVCGVPYTALPLATVICSTNQIPMLIRRKETKDYGTKRLVEGTINPGETCLIIEDVVTSGSSVLETVEVLQKEGLKVTDAIVLLDREQGGKDKLQAHGIRLHSVCTLSKMLEILEQQKKVDAETVGRVKRFIQENVFVAANHNGSPLSIKEAPKELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLGVTRTRPLEQKLISEEDLAANDILDYKDDDDKV | 
                                
                                
                                    | Purity : | 
                                    > 80% as determined by SDS-PAGE and Coomassie blue staining | 
                                
                                
                                    | Stability : | 
                                    Stable for 3 months from receipt of products under proper storage and handling conditions. | 
                                
                                
                                    | Storage : | 
                                    Store at -80 centigrade. Avoid repeated freeze-thaw cycles. | 
                                
                                
                                    | Concentration : | 
                                    50 μg/mL as determined by BCA | 
                                
                                
                                    | Storage Buffer : | 
                                    100 mM glycine, 25 mM Tris-HCl, pH 7.3. |