Recombinant Human UMPS Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | UMPS-3314H |
Product Overview : | UMPS MS Standard C13 and N15-labeled recombinant protein (NP_000364) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a uridine 5'-monophosphate synthase. The encoded protein is a bifunctional enzyme that catalyzes the final two steps of the de novo pyrimidine biosynthetic pathway. The first reaction is carried out by the N-terminal enzyme orotate phosphoribosyltransferase which converts orotic acid to orotidine-5'-monophosphate. The terminal reaction is carried out by the C-terminal enzyme OMP decarboxylase which converts orotidine-5'-monophosphate to uridine monophosphate. Defects in this gene are the cause of hereditary orotic aciduria. Alternate splicing results in multiple transcript variants. |
Molecular Mass : | 52.2 kDa |
AA Sequence : | MAVARAALGPLVTGLYDVQAFKFGDFVLKSGLSSPIYIDLRGIVSRPRLLSQVADILFQTAQNAGISFDTVCGVPYTALPLATVICSTNQIPMLIRRKETKDYGTKRLVEGTINPGETCLIIEDVVTSGSSVLETVEVLQKEGLKVTDAIVLLDREQGGKDKLQAHGIRLHSVCTLSKMLEILEQQKKVDAETVGRVKRFIQENVFVAANHNGSPLSIKEAPKELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLGVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | UMPS uridine monophosphate synthetase [ Homo sapiens (human) ] |
Official Symbol | UMPS |
Synonyms | UMPS; uridine monophosphate synthetase; uridine 5-monophosphate synthase; orotate phosphoribosyl transferase and orotidine 5 decarboxylase; OPRTase; OMPdecase; UMP synthase; orotate phosphoribosyltransferase; orotidine 5-phosphate decarboxylase; OPRT; |
Gene ID | 7372 |
mRNA Refseq | NM_000373 |
Protein Refseq | NP_000364 |
MIM | 613891 |
UniProt ID | P11172 |
◆ Recombinant Proteins | ||
UMPS-349H | Recombinant Human uridine monophosphate synthetase, His-tagged | +Inquiry |
Umps-7928M | Recombinant Mouse Umps protein, His & T7-tagged | +Inquiry |
UMPS-339HFL | Active Recombinant Full Length Human UMPS Protein, C-Flag-tagged | +Inquiry |
Umps-6834M | Recombinant Mouse Umps Protein, Myc/DDK-tagged | +Inquiry |
UMPS-301620H | Recombinant Human UMPS protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
UMPS-503HCL | Recombinant Human UMPS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All UMPS Products
Required fields are marked with *
My Review for All UMPS Products
Required fields are marked with *
0
Inquiry Basket