Recombinant Human UNG Protein, C-Myc/DDK-Tagged

Cat.No. : UNG-02H
Product Overview : Recombinant Human UNG Protein, C-Myc/DDK-Tagged was expressed in HEK293T cell
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes one of several uracil-DNA glycosylases. One important function of uracil-DNA glycosylases is to prevent mutagenesis by eliminating uracil from DNA molecules by cleaving the N-glycosylic bond and initiating the base-excision repair (BER) pathway. Uracil bases occur from cytosine deamination or misincorporation of dUMP residues. Alternative promoter usage and splicing of this gene leads to two different isoforms: the mitochondrial UNG1 and the nuclear UNG2. The UNG2 term was used as a previous symbol for the CCNO gene (GeneID 10309), which has been confused with this gene, in the literature and some databases.
Molecular Mass : 34.5 kDa
AA Sequence : MIGQKTLYSFFSPSPARKRHAPSPEPAVQGTGVAGVPEESGDAAAIPAKKAPAGQEEPGTPPSSPLSAEQ
LDRIQRNKAAALLRLAARNVPVGFGESWKKHLSGEFGKPYFIKLMGFVAEERKHYTVYPPPHQVFTWTQM
CDIKDVKVVILGQDPYHGPNQAHGLCFSVQRPVPPPPSLENIYKELSTDIEDFVHPGHGDLSGWAKQGVL
LLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSP
LSVYRGFFGCRHFSKTNELLQKSGKKPIDWKEL
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80°C.
Concentration : >50 ug/mL as determined by microplate BCA method
Storage Buffer : 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
Gene Name UNG uracil DNA glycosylase [ Homo sapiens (human) ]
Official Symbol UNG
Synonyms DGU; UDG; UNG1; UNG2; HIGM4; HIGM5; UNG15
Gene ID 7374
mRNA Refseq NM_080911.3
Protein Refseq NP_550433
MIM 191525
UniProt ID P13051

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All UNG Products

Required fields are marked with *

My Review for All UNG Products

Required fields are marked with *

0

Inquiry Basket

cartIcon