Recombinant Human UNG Protein, C-Myc/DDK-Tagged
| Cat.No. : | UNG-02H |
| Product Overview : | Recombinant Human UNG Protein, C-Myc/DDK-Tagged was expressed in HEK293T cell |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene encodes one of several uracil-DNA glycosylases. One important function of uracil-DNA glycosylases is to prevent mutagenesis by eliminating uracil from DNA molecules by cleaving the N-glycosylic bond and initiating the base-excision repair (BER) pathway. Uracil bases occur from cytosine deamination or misincorporation of dUMP residues. Alternative promoter usage and splicing of this gene leads to two different isoforms: the mitochondrial UNG1 and the nuclear UNG2. The UNG2 term was used as a previous symbol for the CCNO gene (GeneID 10309), which has been confused with this gene, in the literature and some databases. |
| Molecular Mass : | 34.5 kDa |
| AA Sequence : | MIGQKTLYSFFSPSPARKRHAPSPEPAVQGTGVAGVPEESGDAAAIPAKKAPAGQEEPGTPPSSPLSAEQ LDRIQRNKAAALLRLAARNVPVGFGESWKKHLSGEFGKPYFIKLMGFVAEERKHYTVYPPPHQVFTWTQM CDIKDVKVVILGQDPYHGPNQAHGLCFSVQRPVPPPPSLENIYKELSTDIEDFVHPGHGDLSGWAKQGVL LLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSP LSVYRGFFGCRHFSKTNELLQKSGKKPIDWKEL |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80°C. |
| Concentration : | >50 ug/mL as determined by microplate BCA method |
| Storage Buffer : | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
| Gene Name | UNG uracil DNA glycosylase [ Homo sapiens (human) ] |
| Official Symbol | UNG |
| Synonyms | DGU; UDG; UNG1; UNG2; HIGM4; HIGM5; UNG15 |
| Gene ID | 7374 |
| mRNA Refseq | NM_080911.3 |
| Protein Refseq | NP_550433 |
| MIM | 191525 |
| UniProt ID | P13051 |
| ◆ Recombinant Proteins | ||
| UNG-9922M | Recombinant Mouse UNG Protein, His (Fc)-Avi-tagged | +Inquiry |
| UNG-1547H | Recombinant Human UNG protein | +Inquiry |
| UNG-2559H | Recombinant Human UNG protein, GST-tagged | +Inquiry |
| UNG-02H | Recombinant Human UNG Protein, C-Myc/DDK-Tagged | +Inquiry |
| UNG-0803B | Recombinant Bacillus subtilis UNG protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| ung-8332E | Native E.coli ung | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| UNG-498HCL | Recombinant Human UNG 293 Cell Lysate | +Inquiry |
| UNG-497HCL | Recombinant Human UNG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UNG Products
Required fields are marked with *
My Review for All UNG Products
Required fields are marked with *



