Recombinant Human UNG Protein, C-Myc/DDK-Tagged
Cat.No. : | UNG-02H |
Product Overview : | Recombinant Human UNG Protein, C-Myc/DDK-Tagged was expressed in HEK293T cell |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes one of several uracil-DNA glycosylases. One important function of uracil-DNA glycosylases is to prevent mutagenesis by eliminating uracil from DNA molecules by cleaving the N-glycosylic bond and initiating the base-excision repair (BER) pathway. Uracil bases occur from cytosine deamination or misincorporation of dUMP residues. Alternative promoter usage and splicing of this gene leads to two different isoforms: the mitochondrial UNG1 and the nuclear UNG2. The UNG2 term was used as a previous symbol for the CCNO gene (GeneID 10309), which has been confused with this gene, in the literature and some databases. |
Molecular Mass : | 34.5 kDa |
AA Sequence : | MIGQKTLYSFFSPSPARKRHAPSPEPAVQGTGVAGVPEESGDAAAIPAKKAPAGQEEPGTPPSSPLSAEQ LDRIQRNKAAALLRLAARNVPVGFGESWKKHLSGEFGKPYFIKLMGFVAEERKHYTVYPPPHQVFTWTQM CDIKDVKVVILGQDPYHGPNQAHGLCFSVQRPVPPPPSLENIYKELSTDIEDFVHPGHGDLSGWAKQGVL LLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSP LSVYRGFFGCRHFSKTNELLQKSGKKPIDWKEL |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80°C. |
Concentration : | >50 ug/mL as determined by microplate BCA method |
Storage Buffer : | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Gene Name | UNG uracil DNA glycosylase [ Homo sapiens (human) ] |
Official Symbol | UNG |
Synonyms | DGU; UDG; UNG1; UNG2; HIGM4; HIGM5; UNG15 |
Gene ID | 7374 |
mRNA Refseq | NM_080911.3 |
Protein Refseq | NP_550433 |
MIM | 191525 |
UniProt ID | P13051 |
◆ Recombinant Proteins | ||
UNG-1547H | Recombinant Human UNG protein | +Inquiry |
UNG-2559H | Recombinant Human UNG protein, GST-tagged | +Inquiry |
ung-1546E | Recombinant E.coli ung protein | +Inquiry |
UNG-0803B | Recombinant Bacillus subtilis UNG protein, His-tagged | +Inquiry |
UNG-5763C | Recombinant Chicken UNG | +Inquiry |
◆ Native Proteins | ||
ung-8332E | Native E.coli ung | +Inquiry |
◆ Cell & Tissue Lysates | ||
UNG-498HCL | Recombinant Human UNG 293 Cell Lysate | +Inquiry |
UNG-497HCL | Recombinant Human UNG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UNG Products
Required fields are marked with *
My Review for All UNG Products
Required fields are marked with *