Recombinant Human USP2 protein, His-tagged
| Cat.No. : | USP2-6842H |
| Product Overview : | Recombinant Human USP2 protein(11-241 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 11-241 aa |
| Tag : | N-His |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | YTESARYTDAHYAKSGYGAYTPSSYGANLAASLLEKEKLGFKPVPTSSFLTRPRTYGPSSLLDYDRGRPLLRPDITGGGKRAESQTRGTERPLGSGLSGGSGFPYGVTNNCLSYLPINAYDQGVTLTQKLDSQSDLARDFSSLRTSDSYRIDPRNLGRSPMLARTRKELCTLQGLYQTASCPEYLVDYLENYGRKGSASQVPSQAPPSRVPEIISPTYRPIGRYTLWETGK |
| Gene Name | USP2 ubiquitin specific peptidase 2 [ Homo sapiens ] |
| Official Symbol | USP2 |
| Synonyms | USP2; ubiquitin specific peptidase 2; ubiquitin specific protease 2; ubiquitin carboxyl-terminal hydrolase 2; UBP41; ubiquitin thioesterase 2; deubiquitinating enzyme 2; ubiquitin specific protease 9; ubiquitin specific protease 12; 41 kDa ubiquitin-specific protease; ubiquitin-specific-processing protease 2; USP9; |
| Gene ID | 9099 |
| mRNA Refseq | NM_001243759 |
| Protein Refseq | NP_001230688 |
| MIM | 604725 |
| UniProt ID | O75604 |
| ◆ Recombinant Proteins | ||
| USP2-3620H | Recombinant Human USP2, GST-tagged | +Inquiry |
| USP226345H | Recombinant Human USP2 (260-605)-GSGSGS-FLAG-Ubiquitin (1-71) (E472A, K473A) Protein | +Inquiry |
| USP2-5124R | Recombinant Rhesus monkey USP2 Protein, His-tagged | +Inquiry |
| USP2-9951M | Recombinant Mouse USP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| USP2-153H | Recombinant Human USP2, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| USP2-468HCL | Recombinant Human USP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All USP2 Products
Required fields are marked with *
My Review for All USP2 Products
Required fields are marked with *
