Recombinant Human USP22 protein, GST-tagged
Cat.No. : | USP22-3755H |
Product Overview : | Recombinant Human USP22 protein(130-176 aa), fused to GST tag, was expressed in E. coli. |
Availability | August 02, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 130-176 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | MEEQRKAWKMQGVGEKFSTWEPTKRELELLKHNPKRRKITSNCTIGLR |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | USP22 ubiquitin specific peptidase 22 [ Homo sapiens ] |
Official Symbol | USP22 |
Synonyms | USP22; ubiquitin specific peptidase 22; ubiquitin specific peptidase 3 like , ubiquitin specific protease 22 , USP3L; ubiquitin carboxyl-terminal hydrolase 22; KIAA1063; ubiquitin thioesterase 22; deubiquitinating enzyme 22; ubiquitin thiolesterase 22; ubiquitin specific protease 22; ubiquitin-specific processing protease 22; ubiquitin-specific-processing protease 22; USP3L; |
Gene ID | 23326 |
mRNA Refseq | NM_015276 |
Protein Refseq | NP_056091 |
MIM | 612116 |
UniProt ID | Q9UPT9 |
◆ Recombinant Proteins | ||
USP22-3755H | Recombinant Human USP22 protein, GST-tagged | +Inquiry |
USP22-0536H | Recombinant Human USP22 Protein (V2-E525), His tagged | +Inquiry |
USP22-4255Z | Recombinant Zebrafish USP22 | +Inquiry |
USP22-0535H | Recombinant Human USP22 Protein (V2-E525), Tag Free | +Inquiry |
USP22-45H | Recombinant Human USP22 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
USP22-464HCL | Recombinant Human USP22 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All USP22 Products
Required fields are marked with *
My Review for All USP22 Products
Required fields are marked with *