Recombinant Human USP22 protein, GST-tagged
Cat.No. : | USP22-3755H |
Product Overview : | Recombinant Human USP22 protein(130-176 aa), fused to GST tag, was expressed in E. coli. |
Availability | July 26, 2024 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Source : | E. coli |
Species : | Human |
Tag : | GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
Protein length : | 130-176 aa |
AA Sequence : | MEEQRKAWKMQGVGEKFSTWEPTKRELELLKHNPKRRKITSNCTIGLR |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name : | USP22 ubiquitin specific peptidase 22 [ Homo sapiens ] |
Official Symbol : | USP22 |
Synonyms : | USP22; ubiquitin specific peptidase 22; ubiquitin specific peptidase 3 like , ubiquitin specific protease 22 , USP3L; ubiquitin carboxyl-terminal hydrolase 22; KIAA1063; ubiquitin thioesterase 22; deubiquitinating enzyme 22; ubiquitin thiolesterase 22; ubiquitin specific protease 22; ubiquitin-specific processing protease 22; ubiquitin-specific-processing protease 22; USP3L; |
Gene ID : | 23326 |
mRNA Refseq : | NM_015276 |
Protein Refseq : | NP_056091 |
MIM : | 612116 |
UniProt ID : | Q9UPT9 |
Products Types
◆ Recombinant Protein | ||
USP22-0536H | Recombinant Human USP22 Protein (V2-E525), His tagged | +Inquiry |
USP22-0535H | Recombinant Human USP22 Protein (V2-E525), Tag Free | +Inquiry |
USP22-9953M | Recombinant Mouse USP22 Protein, His (Fc)-Avi-tagged | +Inquiry |
USP22-12H | Active Recombinant Human USP22 protein, His-tagged | +Inquiry |
USP22-45H | Recombinant Human USP22 protein, His-tagged | +Inquiry |
◆ Lysates | ||
USP22-464HCL | Recombinant Human USP22 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Reviews
- Q&As
Ask a Question for All USP22 Products
Required fields are marked with *
My Review for All USP22 Products
Required fields are marked with *
0
Inquiry Basket