Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at Attend ADLM 2024 | July 28 - August 1, 2024

Recombinant Human USP22 protein, GST-tagged

Cat.No. : USP22-3755H
Product Overview : Recombinant Human USP22 protein(130-176 aa), fused to GST tag, was expressed in E. coli.
Availability July 26, 2024
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Source : E. coli
Species : Human
Tag : GST
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
Protein length : 130-176 aa
AA Sequence : MEEQRKAWKMQGVGEKFSTWEPTKRELELLKHNPKRRKITSNCTIGLR
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name : USP22 ubiquitin specific peptidase 22 [ Homo sapiens ]
Official Symbol : USP22
Synonyms : USP22; ubiquitin specific peptidase 22; ubiquitin specific peptidase 3 like , ubiquitin specific protease 22 , USP3L; ubiquitin carboxyl-terminal hydrolase 22; KIAA1063; ubiquitin thioesterase 22; deubiquitinating enzyme 22; ubiquitin thiolesterase 22; ubiquitin specific protease 22; ubiquitin-specific processing protease 22; ubiquitin-specific-processing protease 22; USP3L;
Gene ID : 23326
mRNA Refseq : NM_015276
Protein Refseq : NP_056091
MIM : 612116
UniProt ID : Q9UPT9

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All USP22 Products

Required fields are marked with *

My Review for All USP22 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /
  • Service lnquiry:

Stay Updated on the Latest Bioscience Trends