Recombinant Human USP22 protein, GST-tagged

• Cat.No.: USP22-3755H
• Product Overview: Recombinant Human USP22 protein(130-176 aa), fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 130-176 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• AA Sequence: MEEQRKAWKMQGVGEKFSTWEPTKRELELLKHNPKRRKITSNCTIGLR
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: USP22 ubiquitin specific peptidase 22 [ Homo sapiens ]
• Official Symbol: USP22
• Synonyms: USP22; ubiquitin specific peptidase 22; ubiquitin specific peptidase 3 like , ubiquitin specific protease 22 , USP3L; ubiquitin carboxyl-terminal hydrolase 22; KIAA1063; ubiquitin thioesterase 22; deubiquitinating enzyme 22; ubiquitin thiolesterase 22; ubiquitin specific protease 22; ubiquitin-specific processing protease 22; ubiquitin-specific-processing protease 22; USP3L
• Gene ID: 23326
• mRNA Refseq: NM_015276
• Protein Refseq: NP_056091
• MIM: 612116
• UniProt ID: Q9UPT9