Recombinant Human USP6NL protein, His-tagged
Cat.No. : | USP6NL-7855H |
Product Overview : | Recombinant Human USP6NL protein(1-160 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | His |
Protein Length : | 1-160 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | MNSDQDVALKLAQERAEIVAKYDRGREGAEIEPWEDADYLVYKVTDRFGFLHEEELPDHNVAVERQKHLEIERTTKWLKMLKGWEKYKNTEKFHRRIYKGIPLQLRGEVWALLLEIPKMKEETRDLYSKLKHRARGCSPDIRQIDLDVNRTFRDHIMFRD |
Purity : | 85%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | USP6NL USP6 N-terminal like [ Homo sapiens ] |
Official Symbol | USP6NL |
Synonyms | USP6NL; USP6 N-terminal like; USP6 N-terminal-like protein; KIAA0019; related to the N terminus of tre; RN tre; RNTRE; TRE2NL; RN-tre; related to the N-terminus of tre; |
mRNA Refseq | NM_001080491 |
Protein Refseq | NP_001073960 |
MIM | 605405 |
UniProt ID | Q92738 |
Gene ID | 9712 |
◆ Recombinant Proteins | ||
USP6NL-6714H | Recombinant Human USP6NL Protein (Met1-Gly292), N-His tagged | +Inquiry |
USP6NL-17942M | Recombinant Mouse USP6NL Protein | +Inquiry |
USP6NL-7855H | Recombinant Human USP6NL protein, His-tagged | +Inquiry |
USP6NL-4944R | Recombinant Rhesus Macaque USP6NL Protein, His (Fc)-Avi-tagged | +Inquiry |
USP6NL-2536C | Recombinant Chicken USP6NL | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All USP6NL Products
Required fields are marked with *
My Review for All USP6NL Products
Required fields are marked with *