Recombinant Human USP8 protein, GST-tagged
Cat.No. : | USP8-301310H |
Product Overview : | Recombinant Human USP8 (15-253 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Ser15-Val253 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | SSLKDLNKKTEVKPEKISTKSYVHSALKIFKTAEECRLDRDEERAYVLYMKYVTVYNLIKKRPDFKQQQDYFHSILGPGNIKKAVEEAERLSESLKLRYEEAEVRKKLEEKDRQEEAQRLQQKRQETGREDGGTLAKGSLENVLDSKDKTQKSNGEKNEKCETKEKGAITAKELYTMMTDKNISLIIMDARRMQDYQDSCILHSLSVPEEAISPGVTASWIEAHLPDDSKDTWKKRGNV |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | USP8 ubiquitin specific peptidase 8 [ Homo sapiens ] |
Official Symbol | USP8 |
Synonyms | USP8; ubiquitin specific peptidase 8; ubiquitin specific protease 8; ubiquitin carboxyl-terminal hydrolase 8; HumORF8; KIAA0055; UBPY; hUBPy; ubiquitin isopeptidase Y; ubiquitin thioesterase 8; deubiquitinating enzyme 8; ubiquitin thiolesterase 8; ubiquitin-specific-processing protease 8; FLJ34456; MGC129718; |
Gene ID | 9101 |
mRNA Refseq | NM_001128610 |
Protein Refseq | NP_001122082 |
MIM | 603158 |
UniProt ID | P40818 |
◆ Recombinant Proteins | ||
USP8-0544H | Recombinant Human USP8 Protein (A182-T318), Tag Free | +Inquiry |
USP8-3938H | Recombinant Human USP8 protein, His-tagged | +Inquiry |
USP8-0543H | Recombinant Human USP8 Protein (A182-T318), His tagged | +Inquiry |
USP8-3738H | Recombinant Human USP8 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
USP8-161H | Recombinant Human USP8, His & SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
USP8-451HCL | Recombinant Human USP8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All USP8 Products
Required fields are marked with *
My Review for All USP8 Products
Required fields are marked with *