Recombinant Human USP8 protein, GST-tagged

Cat.No. : USP8-301310H
Product Overview : Recombinant Human USP8 (15-253 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Ser15-Val253
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : SSLKDLNKKTEVKPEKISTKSYVHSALKIFKTAEECRLDRDEERAYVLYMKYVTVYNLIKKRPDFKQQQDYFHSILGPGNIKKAVEEAERLSESLKLRYEEAEVRKKLEEKDRQEEAQRLQQKRQETGREDGGTLAKGSLENVLDSKDKTQKSNGEKNEKCETKEKGAITAKELYTMMTDKNISLIIMDARRMQDYQDSCILHSLSVPEEAISPGVTASWIEAHLPDDSKDTWKKRGNV
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name USP8 ubiquitin specific peptidase 8 [ Homo sapiens ]
Official Symbol USP8
Synonyms USP8; ubiquitin specific peptidase 8; ubiquitin specific protease 8; ubiquitin carboxyl-terminal hydrolase 8; HumORF8; KIAA0055; UBPY; hUBPy; ubiquitin isopeptidase Y; ubiquitin thioesterase 8; deubiquitinating enzyme 8; ubiquitin thiolesterase 8; ubiquitin-specific-processing protease 8; FLJ34456; MGC129718;
Gene ID 9101
mRNA Refseq NM_001128610
Protein Refseq NP_001122082
MIM 603158
UniProt ID P40818

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All USP8 Products

Required fields are marked with *

My Review for All USP8 Products

Required fields are marked with *

0
cart-icon
0
compare icon