Recombinant Human USPL1 protein, His-tagged
Cat.No. : | USPL1-2942H |
Product Overview : | Recombinant Human USPL1 protein(31-220 aa), fused to His tag, was expressed in E. coli. |
Availability | August 23, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 31-220 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | LGKNFDSAKVPSDEYCPACREKGKLKALKTYRISFQESIFLCEDLQCIYPLGSKSLNNLISPDLEECHTPHKPQKRKSLESSYKDSLLLANSKKTRNYIAIDGGKVLNSKHNGEVYDETSSNLPDSSGQQNPIRTADSLERNEILEADTVDMATTKDPATVDVSGTGRPSPQNEGCTSKLEMPLESKCTS |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | USPL1 ubiquitin specific peptidase like 1 [ Homo sapiens ] |
Official Symbol | USPL1 |
Synonyms | USPL1; ubiquitin specific peptidase like 1; C13orf22, chromosome 13 open reading frame 22; ubiquitin-specific peptidase-like protein 1; bA121O19.1; D13S106E; highly charged protein; C13orf22; FLJ32952; RP11-121O19.1; DKFZp781K2286; |
Gene ID | 10208 |
mRNA Refseq | NM_005800 |
Protein Refseq | NP_005791 |
UniProt ID | Q5W0Q7 |
◆ Recombinant Proteins | ||
USPL1-1167Z | Recombinant Zebrafish USPL1 | +Inquiry |
USPL1-3966C | Recombinant Chicken USPL1 | +Inquiry |
USPL1-17947M | Recombinant Mouse USPL1 Protein | +Inquiry |
USPL1-524H | Recombinant Human USPL1 Protein, GST-tagged | +Inquiry |
USPL1-9978M | Recombinant Mouse USPL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All USPL1 Products
Required fields are marked with *
My Review for All USPL1 Products
Required fields are marked with *