Recombinant Human VASH1 Protein, His-tagged
Cat.No. : | VASH1-14H |
Product Overview : | Vasohibin 1 / VASH1 Protein is Recombinant Human Vasohibin 1 / VASH1 aa 1-204 produced in E. coli with 6 His, N-terminus tag(s). |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-204 a.a. |
Description : | Tyrosine carboxypeptidase that removes the C-terminal tyrosine residue of alpha-tubulin, thereby regulating microtubule dynamics and function. Acts as an angiogenesis inhibitor: inhibits migration, proliferation and network formation by endothelial cells as well as angiogenesis. This inhibitory effect is selective to endothelial cells as it does not affect the migration of smooth muscle cells or fibroblasts. |
Molecular Mass : | 25.93 kD |
AA Sequence : | MPGGKKVAGGGSSGATPTSAAATAPSGVRRLETSEGTSAQRDEEPEEEGEEDLRDGGVPFFVNRGGLPVDEATWERMWKHVAKIHPDGEKVAQRIRGATDLPKIPIPSVPTFQPSTPVPERLEAVQRYIRELQYNHTGTQFFEIKKSRPLTGLMDLAKEMTKEALPIKCLEAVILGMYPSSPEGEGSGLLWASASCSESEGGVG |
Notes : | For research use only. |
Storage : | Short term: -20 centigrade; Long term: -80 centigrade; Avoid freeze-thaw cycles. |
Storage Buffer : | Tris, 50% Glycerol |
Gene Name | VASH1 vasohibin 1 [ Homo sapiens (human) ] |
Official Symbol | VASH1 |
Synonyms | VASH1; vasohibin 1; TTCP 1; KIAA1036; tubulinyl-Tyr carboxypeptidase 1; vasohibin-1; tubulin carboxypeptidase 1; tyrosine carboxypeptidase 1; EC 3.4.17.17 |
Gene ID | 22846 |
mRNA Refseq | NM_014909 |
Protein Refseq | NP_055724 |
MIM | 609011 |
UniProt ID | Q7L8A9 |
◆ Recombinant Proteins | ||
VASH1-9996M | Recombinant Mouse VASH1 Protein, His (Fc)-Avi-tagged | +Inquiry |
VASH1-14H | Recombinant Human VASH1 Protein, His-tagged | +Inquiry |
VASH1-3096HFL | Recombinant Full Length Human VASH1 Protein, His tagged | +Inquiry |
VASH1-4960R | Recombinant Rhesus Macaque VASH1 Protein, His (Fc)-Avi-tagged | +Inquiry |
VASH1-3095HFL | Recombinant Full Length Human VASH1 protein, Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
VASH1-428HCL | Recombinant Human VASH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All VASH1 Products
Required fields are marked with *
My Review for All VASH1 Products
Required fields are marked with *
0
Inquiry Basket