Recombinant Human VASH1 Protein, His-tagged

Cat.No. : VASH1-14H
Product Overview : Vasohibin 1 / VASH1 Protein is Recombinant Human Vasohibin 1 / VASH1 aa 1-204 produced in E. coli with 6 His, N-terminus tag(s).
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-204 a.a.
Description : Tyrosine carboxypeptidase that removes the C-terminal tyrosine residue of alpha-tubulin, thereby regulating microtubule dynamics and function. Acts as an angiogenesis inhibitor: inhibits migration, proliferation and network formation by endothelial cells as well as angiogenesis. This inhibitory effect is selective to endothelial cells as it does not affect the migration of smooth muscle cells or fibroblasts.
Molecular Mass : 25.93 kD
AA Sequence : MPGGKKVAGGGSSGATPTSAAATAPSGVRRLETSEGTSAQRDEEPEEEGEEDLRDGGVPFFVNRGGLPVDEATWERMWKHVAKIHPDGEKVAQRIRGATDLPKIPIPSVPTFQPSTPVPERLEAVQRYIRELQYNHTGTQFFEIKKSRPLTGLMDLAKEMTKEALPIKCLEAVILGMYPSSPEGEGSGLLWASASCSESEGGVG
Notes : For research use only.
Storage : Short term: -20 centigrade; Long term: -80 centigrade; Avoid freeze-thaw cycles.
Storage Buffer : Tris, 50% Glycerol
Gene Name VASH1 vasohibin 1 [ Homo sapiens (human) ]
Official Symbol VASH1
Synonyms VASH1; vasohibin 1; TTCP 1; KIAA1036; tubulinyl-Tyr carboxypeptidase 1; vasohibin-1; tubulin carboxypeptidase 1; tyrosine carboxypeptidase 1; EC 3.4.17.17
Gene ID 22846
mRNA Refseq NM_014909
Protein Refseq NP_055724
MIM 609011
UniProt ID Q7L8A9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All VASH1 Products

Required fields are marked with *

My Review for All VASH1 Products

Required fields are marked with *

0
cart-icon