Recombinant Human VEGFB protein
Cat.No. : | VEGFB-785H |
Product Overview : | Recombinant Human VEGFB protein(P49765)(31-129aa) was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 31-129a.a. |
Tag : | Non |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 11.3 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | HQRKVVSWIDVYTRATCQPREVVVPLTVELMGTVAKQLVPSCVTVQRCGGCCPDDGLECVPTGQHQVRMQILMIRYPSSQLGEMSLEEHSQCECRPKKK |
Gene Name | VEGFB vascular endothelial growth factor B [ Homo sapiens ] |
Official Symbol | VEGFB |
Synonyms | VEGFB; vascular endothelial growth factor B; VRF; VEGFL; VEGF-related factor; |
Gene ID | 7423 |
mRNA Refseq | NM_001243733 |
Protein Refseq | NP_001230662 |
MIM | 601398 |
UniProt ID | P49765 |
◆ Recombinant Proteins | ||
VEGFB-6514R | Recombinant Rat VEGFB Protein | +Inquiry |
VEGFB-18005M | Recombinant Mouse VEGFB Protein | +Inquiry |
VEGFB-107H | Active Recombinant Human VEGFB Protein | +Inquiry |
VEGFB-6557H | Recombinant Human VEGFB Protein (Pro22-Arg188), C-His tagged | +Inquiry |
VEGFB-597D | Recombinant Dog VEGFB protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
VEGFB-416HCL | Recombinant Human VEGFB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VEGFB Products
Required fields are marked with *
My Review for All VEGFB Products
Required fields are marked with *