Recombinant Human VENTX Protein (1-258 aa), GST-tagged
Cat.No. : | VENTX-2121H |
Product Overview : | Recombinant Human VENTX Protein (1-258 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-258 aa |
Description : | VENT homeobox homolog VENT-like homeobox protein 2. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 54.6 kDa |
AA Sequence : | MRLSSSPPRGPQQLSSFGSVDWLSQSSCSGPTHTPRPADFSLGSLPGPGQTSGAREPPQAVSIKEAAGSSNLPAPERTMAGLSKEPNTLRAPRVRTAFTMEQVRTLEGVFQHHQYLSPLERKRLAREMQLSEVQIKTWFQNRRMKHKRQMQDPQLHSPFSGSLHAPPAFYSTSSGLANGLQLLCPWAPLSGPQALMLPPGSFWGLCQVAQEALASAGASCCGQPLASHPPTPGRPSLGPALSTGPRGLCAMPQTGDAF |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | VENTX VENT homeobox [ Homo sapiens ] |
Official Symbol | VENTX |
Synonyms | VENTX; VENT homeobox; HPX42B; VENT-like homeobox 2; NA88A; VENTX2; MGC119910; MGC119911; |
Gene ID | 27287 |
mRNA Refseq | NM_014468 |
Protein Refseq | NP_055283 |
MIM | 607158 |
UniProt ID | O95231 |
◆ Recombinant Proteins | ||
VENTX-2121H | Recombinant Human VENTX Protein (1-258 aa), GST-tagged | +Inquiry |
VENTX-5081H | Recombinant Human VENTX Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
VENTX-415HCL | Recombinant Human VENTX 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VENTX Products
Required fields are marked with *
My Review for All VENTX Products
Required fields are marked with *
0
Inquiry Basket