Recombinant Human VENTX Protein (1-258 aa), GST-tagged

• Cat.No.: VENTX-2121H
• Product Overview: Recombinant Human VENTX Protein (1-258 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Full Length.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-258 aa
• Description: VENT homeobox homolog VENT-like homeobox protein 2.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 54.6 kDa
• AA Sequence: MRLSSSPPRGPQQLSSFGSVDWLSQSSCSGPTHTPRPADFSLGSLPGPGQTSGAREPPQAVSIKEAAGSSNLPAPERTMAGLSKEPNTLRAPRVRTAFTMEQVRTLEGVFQHHQYLSPLERKRLAREMQLSEVQIKTWFQNRRMKHKRQMQDPQLHSPFSGSLHAPPAFYSTSSGLANGLQLLCPWAPLSGPQALMLPPGSFWGLCQVAQEALASAGASCCGQPLASHPPTPGRPSLGPALSTGPRGLCAMPQTGDAF
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: VENTX VENT homeobox [ Homo sapiens ]
• Official Symbol: VENTX
• Synonyms: VENTX; VENT homeobox; HPX42B; VENT-like homeobox 2; NA88A; VENTX2; MGC119910; MGC119911
• Gene ID: 27287
• mRNA Refseq: NM_014468
• Protein Refseq: NP_055283
• MIM: 607158
• UniProt ID: O95231