Recombinant Human VENTX Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: VENTX-5081H
• Product Overview: VENTX MS Standard C13 and N15-labeled recombinant protein (NP_055283) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a member of the Vent family of homeodomain proteins. The encoded protein may function as a transcriptional repressor and be involved in mesodermal patterning and hemopoietic stem cell maintenance. Multiple pseudogenes exist for this gene. A transcribed pseudogene located on chromosome X may lead to antigen production in certain melanomas.
• Molecular Mass: 27.5 kDa
• AA Sequence: MRLSSSPPRGPQQLSSFGSVDWLSQSSCSGPTHTPRPADFSPGSLPGPGQTSGAREPPQAVSIKEAAGSSNLPAPERTMAGLSKEPNTLRAPRVRTAFTMEQVRTLEGVFQHHQYLSPLERKRLAREMQLSEVQIKTWFQNRRMKHKRQMQDPQLHSPFSGSLHAPPAFYSTSSGLANGLQLLCPWAPLSGPQALMLPPGSFWGLCQVAQEALASAGASCCGQPLASHPPTPGRPSLGPALSTGPRGLCAMPQTGDAFTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: VENTX VENT homeobox [ Homo sapiens (human) ]
• Official Symbol: VENTX
• Synonyms: VENTX; VENT homeobox; VENT homeobox homolog (Xenopus laevis), VENT like homeobox 2, VENTX2; homeobox protein VENTX; HPX42B; VENT-like homeobox 2; VENT homeobox homolog; VENT-like homeobox protein 2; hemopoietic progenitor homeobox protein VENTX2; NA88A; VENTX2; MGC119910; MGC119911
• Gene ID: 27287
• mRNA Refseq: NM_014468
• Protein Refseq: NP_055283
• MIM: 607158
• UniProt ID: O95231