Recombinant Human VENTX Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : VENTX-5081H
Product Overview : VENTX MS Standard C13 and N15-labeled recombinant protein (NP_055283) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a member of the Vent family of homeodomain proteins. The encoded protein may function as a transcriptional repressor and be involved in mesodermal patterning and hemopoietic stem cell maintenance. Multiple pseudogenes exist for this gene. A transcribed pseudogene located on chromosome X may lead to antigen production in certain melanomas.
Molecular Mass : 27.5 kDa
AA Sequence : MRLSSSPPRGPQQLSSFGSVDWLSQSSCSGPTHTPRPADFSPGSLPGPGQTSGAREPPQAVSIKEAAGSSNLPAPERTMAGLSKEPNTLRAPRVRTAFTMEQVRTLEGVFQHHQYLSPLERKRLAREMQLSEVQIKTWFQNRRMKHKRQMQDPQLHSPFSGSLHAPPAFYSTSSGLANGLQLLCPWAPLSGPQALMLPPGSFWGLCQVAQEALASAGASCCGQPLASHPPTPGRPSLGPALSTGPRGLCAMPQTGDAFTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name VENTX VENT homeobox [ Homo sapiens (human) ]
Official Symbol VENTX
Synonyms VENTX; VENT homeobox; VENT homeobox homolog (Xenopus laevis), VENT like homeobox 2, VENTX2; homeobox protein VENTX; HPX42B; VENT-like homeobox 2; VENT homeobox homolog; VENT-like homeobox protein 2; hemopoietic progenitor homeobox protein VENTX2; NA88A; VENTX2; MGC119910; MGC119911;
Gene ID 27287
mRNA Refseq NM_014468
Protein Refseq NP_055283
MIM 607158
UniProt ID O95231

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All VENTX Products

Required fields are marked with *

My Review for All VENTX Products

Required fields are marked with *

0

Inquiry Basket

cartIcon