Recombinant Human VHL protein, His-tagged
| Cat.No. : | VHL-3754H |
| Product Overview : | Recombinant Human VHL protein(P40337)(1-213aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-213aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 28.2 kDa |
| AA Sequence : | MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | VHL von Hippel-Lindau tumor suppressor, E3 ubiquitin protein ligase [ Homo sapiens ] |
| Official Symbol | VHL |
| Synonyms | VHL; von Hippel-Lindau tumor suppressor, E3 ubiquitin protein ligase; von Hippel Lindau syndrome , von Hippel Lindau tumor suppressor; von Hippel-Lindau disease tumor suppressor; VHL1; protein G7; elongin binding protein; RCA1; pVHL; HRCA1; |
| Gene ID | 7428 |
| mRNA Refseq | NM_000551 |
| Protein Refseq | NP_000542 |
| MIM | 608537 |
| UniProt ID | P40337 |
| ◆ Recombinant Proteins | ||
| VHL-693H | Recombinant Human VHL Protein, His-tagged | +Inquiry |
| VHL-5643H | Recombinant Human VHL protein, MBP&His-Avi-tagged, Biotinylated | +Inquiry |
| VHL-29832TH | Recombinant Human VHL, His-tagged | +Inquiry |
| VHL-6521R | Recombinant Rat VHL Protein | +Inquiry |
| VHL-5155Z | Recombinant Zebrafish VHL | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| VHL-410HCL | Recombinant Human VHL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VHL Products
Required fields are marked with *
My Review for All VHL Products
Required fields are marked with *
