Recombinant Human VHL protein, MBP&His-Avi-tagged, Biotinylated

Cat.No. : VHL-5643H
Product Overview : Biotinylated Recombinant Human VHL protein(P40337)(1-213aa), fused with N-terminal MBP tag and C-terminal His and Avi tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Avi&His&MBP
Protein Length : 1-213aa
Conjugation/Label : Biotin
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 71.9 kDa
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD
Conjugation : Biotin
Gene Name VHL von Hippel-Lindau tumor suppressor, E3 ubiquitin protein ligase [ Homo sapiens ]
Official Symbol VHL
Synonyms VHL; von Hippel-Lindau tumor suppressor, E3 ubiquitin protein ligase; von Hippel Lindau syndrome , von Hippel Lindau tumor suppressor; von Hippel-Lindau disease tumor suppressor; VHL1; protein G7; elongin binding protein; RCA1; pVHL; HRCA1;
Gene ID 7428
mRNA Refseq NM_000551
Protein Refseq NP_000542
MIM 608537
UniProt ID P40337

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All VHL Products

Required fields are marked with *

My Review for All VHL Products

Required fields are marked with *

0
cart-icon