Recombinant Human VIM protein, T7/His-tagged
| Cat.No. : | VIM-203H |
| Product Overview : | Recombinant human VIM (465aa, derived from BC000163) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&T7 |
| Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose, DTT. |
| AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGEFSTRSVSSSSYRRMFGGPGTASRPSSSRSYVTTSTRTYSLGSALRPS TSRSLYASSPGGVYATRSSAVRLRSSVPGVRLLQDSVDFSLADAINTEFKNTRTNEKVELQELNDRFANYIDKVR FLEQQNKILLAELEQLKGQGKSRLGDLYEEEMRELRRQVDQLTNDKARVEVERDNLAEDIMRLREKLQEEMLQRE EAENTLQSFRQDVDNASLARLDLERKVESLQEEIAFLKKLHEEEIQELQAQIQEQHVQIDVDVSKPDLTAALRDV RQQYESVAAKNLQEAEEWYKSKFADLSEAANRNNDALRQAKQESTEYRRQVQSLTCEVDALKGTNESLERQMREM EENFAVEAANYQDTIGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRISLPLPNFSSLN LRETNLDSLPLVDTHSKRTLLIKTVETRDGQVINETSQHHDDLE |
| Purity : | >90% by SDS-PAGE |
| Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
| Gene Name | VIM vimentin [ Homo sapiens ] |
| Official Symbol | VIM |
| Synonyms | VIM; vimentin; FLJ36605; |
| Gene ID | 7431 |
| mRNA Refseq | NM_003380 |
| Protein Refseq | NP_003371 |
| MIM | |
| UniProt ID | P08670 |
| Chromosome Location | 10p13 |
| Pathway | Alpha6-Beta4 Integrin Signaling Pathway, organism-specific biosystem; Apoptosis, organism-specific biosystem; Apoptotic cleavage of cellular proteins, organism-specific biosystem; Apoptotic executionphase, organism-specific biosystem; Aurora B signaling, organism-specific biosystem; Caspase cascade in apoptosis, organism-specific biosystem; Caspase-mediated cleavage of cytoskeletal proteins, organism-specific biosystem; |
| Function | identical protein binding; protein C-terminus binding; protein binding; structural constituent of cytoskeleton; |
| ◆ Recombinant Proteins | ||
| VIM-4679H | Recombinant Human Vimentin, GST-tagged | +Inquiry |
| VIM-185H | Recombinant human VIM | +Inquiry |
| VIM-10017M | Recombinant Mouse VIM Protein, His (Fc)-Avi-tagged | +Inquiry |
| VIM-16H | Recombinant Human VIM Full Length protein, His-tagged | +Inquiry |
| VIM-9376Z | Recombinant Zebrafish VIM | +Inquiry |
| ◆ Native Proteins | ||
| WIM-5415B | Native Bovine Vimentin | +Inquiry |
| VIM-21H | Recombinant Human Citrullinated VIM Protein | +Inquiry |
| VIM-186B | Native bovine VIM | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| VIM-1907HCL | Recombinant Human VIM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VIM Products
Required fields are marked with *
My Review for All VIM Products
Required fields are marked with *
