Recombinant Human VKORC1 Protein, His tagged
| Cat.No. : | VKORC1-001H |
| Product Overview : | Recombinant Human VKORC1 Protein with His tag was expressed in Baculovirus-Insect Cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Baculovirus-Insect Cells |
| Tag : | His |
| Protein Length : | 30-100 aa |
| Description : | This gene encodes the catalytic subunit of the vitamin K epoxide reductase complex, which is responsible for the reduction of inactive vitamin K 2,3-epoxide to active vitamin K in the endoplasmic reticulum membrane. Vitamin K is a required co-factor for carboxylation of glutamic acid residues by vitamin K-dependent gamma-carboxylase in blood-clotting enzymes. Allelic variation in this gene is associated with vitamin k-dependent clotting factors combined deficiency of 2, and increased resistance or sensitivity to warfarin, an inhibitor of vitamin K epoxide reductase. Pseudogenes of this gene are located on chromosomes 1 and X. Alternative splicing results in multiple transcript variants. |
| Form : | Sterile PBS, pH7.4, 0.1% SKL |
| Molecular Mass : | 9 kDa |
| AASequence : | MHHHHHHHHHHKAARARDRDYRALCDVGTAISCSRVFSSRWGRGFGLVEHVLGQDSILNQSNSIFGCIFYTLQLLLGCLRTR |
| Endotoxin : | < 1 EU/μg by LAL |
| Purity : | > 70% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 1 mg/mL by BCA |
| Gene Name | VKORC1 vitamin K epoxide reductase complex, subunit 1 [ Homo sapiens (human) ] |
| Official Symbol | VKORC1 |
| Synonyms | VKORC1; vitamin K epoxide reductase complex, subunit 1; vitamin K dependent clotting factors deficiency 2, VKCFD2; vitamin K epoxide reductase complex subunit 1; phylloquinone epoxide reductase; vitamin K1 2,3-epoxide reductase subunit 1; vitamin K dependent clotting factors deficiency 2; vitamin K1 epoxide reductase (warfarin-sensitive); VKOR; MST134; MST576; VKCFD2; EDTP308; IMAGE3455200; MGC2694; FLJ00289 |
| Gene ID | 79001 |
| mRNA Refseq | NM_024006 |
| Protein Refseq | NP_076869 |
| MIM | 608547 |
| UniProt ID | Q9BQB6 |
| ◆ Recombinant Proteins | ||
| VKORC1-0608H | Recombinant Human VKORC1 Protein (S3-E155), sfGFP, 10×His tagged | +Inquiry |
| VKORC1-14HFL | Recombinant Human Full Length VKORC1 Protein, Flag tagged | +Inquiry |
| Vkorc1-6925M | Recombinant Mouse Vkorc1 Protein, Myc/DDK-tagged | +Inquiry |
| VKORC1-08H | Recombinant Human VKORC1-sfGFP Protein (M1-H163 end), C-10×His-tagged | +Inquiry |
| VKORC1-20H | Recombinant Human VKORC1-GFP Protein (S3-E155), C-10×His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| VKORC1-405HCL | Recombinant Human VKORC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VKORC1 Products
Required fields are marked with *
My Review for All VKORC1 Products
Required fields are marked with *



