Recombinant Human VKORC1 Protein, His tagged

• Cat.No.: VKORC1-001H
• Product Overview: Recombinant Human VKORC1 Protein with His tag was expressed in Baculovirus-Insect Cells.

Specification

• Species: Human
• Source: Baculovirus-Insect Cells
• Tag: His
• Protein Length: 30-100 aa
• Description: This gene encodes the catalytic subunit of the vitamin K epoxide reductase complex, which is responsible for the reduction of inactive vitamin K 2,3-epoxide to active vitamin K in the endoplasmic reticulum membrane. Vitamin K is a required co-factor for carboxylation of glutamic acid residues by vitamin K-dependent gamma-carboxylase in blood-clotting enzymes. Allelic variation in this gene is associated with vitamin k-dependent clotting factors combined deficiency of 2, and increased resistance or sensitivity to warfarin, an inhibitor of vitamin K epoxide reductase. Pseudogenes of this gene are located on chromosomes 1 and X. Alternative splicing results in multiple transcript variants.
• Form: Sterile PBS, pH7.4, 0.1% SKL
• Molecular Mass: 9 kDa
• AASequence: MHHHHHHHHHHKAARARDRDYRALCDVGTAISCSRVFSSRWGRGFGLVEHVLGQDSILNQSNSIFGCIFYTLQLLLGCLRTR
• Endotoxin: < 1 EU/μg by LAL
• Purity: > 70% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 1 mg/mL by BCA

Gene Information

• Gene Name: VKORC1 vitamin K epoxide reductase complex, subunit 1 [ Homo sapiens (human) ]
• Official Symbol: VKORC1
• Synonyms: VKORC1; vitamin K epoxide reductase complex, subunit 1; vitamin K dependent clotting factors deficiency 2, VKCFD2; vitamin K epoxide reductase complex subunit 1; phylloquinone epoxide reductase; vitamin K1 2,3-epoxide reductase subunit 1; vitamin K dependent clotting factors deficiency 2; vitamin K1 epoxide reductase (warfarin-sensitive); VKOR; MST134; MST576; VKCFD2; EDTP308; IMAGE3455200; MGC2694; FLJ00289
• Gene ID: 79001
• mRNA Refseq: NM_024006
• Protein Refseq: NP_076869
• MIM: 608547
• UniProt ID: Q9BQB6