Recombinant Human VPREB3 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | VPREB3-2573H |
Product Overview : | VPREB3 MS Standard C13 and N15-labeled recombinant protein (NP_037510) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is the human ortholog of the mouse VpreB3 (8HS20) protein, is thought to be involved in B-cell maturation, and may play a role in assembly of the pre-B cell receptor (pre-BCR). While the role of this protein in B-cell development has not yet been elucidated, studies with the chicken ortholog of this protein have found that when overexpressed, this protein localizes to the endoplasmic reticulum. The mouse ortholog of this protein has been shown to associate with membrane mu heavy chains early in the course of pre-B cell receptor biosynthesis. Expression of this gene has been observed in some lymphomas. |
Molecular Mass : | 13.7 kDa |
AA Sequence : | MACRCLSFLLMGTFLSVSQTVLAQLDALLVFPGQVAQLSCTLSPQHVTIRDYGVSWYQQRAGSAPRYLLYYRSEEDHHRPADIPDRFSAAKDEAHNACVLTISPVQPEDDADYYCSVGYGFSPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | VPREB3 pre-B lymphocyte 3 [ Homo sapiens (human) ] |
Official Symbol | VPREB3 |
Synonyms | VPREB3; pre-B lymphocyte 3; pre-B lymphocyte protein 3; 8HS20; pre-B lymphocyte gene 3; N27C7-2; |
Gene ID | 29802 |
mRNA Refseq | NM_013378 |
Protein Refseq | NP_037510 |
MIM | 605017 |
UniProt ID | Q9UKI3 |
◆ Recombinant Proteins | ||
Vpreb3-6929M | Recombinant Mouse Vpreb3 Protein, Myc/DDK-tagged | +Inquiry |
VPREB3-2573H | Recombinant Human VPREB3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
VPREB3-398HCL | Recombinant Human VPREB3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VPREB3 Products
Required fields are marked with *
My Review for All VPREB3 Products
Required fields are marked with *
0
Inquiry Basket