Recombinant Human VPREB3 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : VPREB3-2573H
Product Overview : VPREB3 MS Standard C13 and N15-labeled recombinant protein (NP_037510) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene is the human ortholog of the mouse VpreB3 (8HS20) protein, is thought to be involved in B-cell maturation, and may play a role in assembly of the pre-B cell receptor (pre-BCR). While the role of this protein in B-cell development has not yet been elucidated, studies with the chicken ortholog of this protein have found that when overexpressed, this protein localizes to the endoplasmic reticulum. The mouse ortholog of this protein has been shown to associate with membrane mu heavy chains early in the course of pre-B cell receptor biosynthesis. Expression of this gene has been observed in some lymphomas.
Molecular Mass : 13.7 kDa
AA Sequence : MACRCLSFLLMGTFLSVSQTVLAQLDALLVFPGQVAQLSCTLSPQHVTIRDYGVSWYQQRAGSAPRYLLYYRSEEDHHRPADIPDRFSAAKDEAHNACVLTISPVQPEDDADYYCSVGYGFSPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name VPREB3 pre-B lymphocyte 3 [ Homo sapiens (human) ]
Official Symbol VPREB3
Synonyms VPREB3; pre-B lymphocyte 3; pre-B lymphocyte protein 3; 8HS20; pre-B lymphocyte gene 3; N27C7-2;
Gene ID 29802
mRNA Refseq NM_013378
Protein Refseq NP_037510
MIM 605017
UniProt ID Q9UKI3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All VPREB3 Products

Required fields are marked with *

My Review for All VPREB3 Products

Required fields are marked with *

0
cart-icon