Recombinant Human VPS18 protein, His-tagged
Cat.No. : | VPS18-20H |
Product Overview : | Recombinant Human VPS18 protein(Arg821-Leu970), fused with N-terminal SUMO tag and C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | Arg821-Leu970 |
Tag : | N-SUMO & C-His |
Form : | Phosphate buffered saline |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | REMEEATASAQRIRRDLQELRGRYGTVEPQDKCATCDFPLLNRPFYLFLCGHMFHADCLLQAVRPGLPAYKQARLEELQRKLGAAPPPAKGSARAKEAEGGAATAGPSREQLKADLDELVAAECVYCGELMIRSIDRPFIDPQRYEEEQL |
Gene Name | VPS18 vacuolar protein sorting 18 homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | VPS18 |
Synonyms | VPS18; vacuolar protein sorting 18 homolog (S. cerevisiae); vacuolar protein sorting protein 18; vacuolar protein sorting-associated protein 18 homolog; KIAA1475; PEP3; hVPS18; |
Gene ID | 57617 |
mRNA Refseq | NM_020857 |
Protein Refseq | NP_065908 |
MIM | 608551 |
UniProt ID | Q9P253 |
◆ Recombinant Proteins | ||
VPS18-5166R | Recombinant Rhesus monkey VPS18 Protein, His-tagged | +Inquiry |
VPS18-20H | Recombinant Human VPS18 protein, His-tagged | +Inquiry |
VPS18-9519Z | Recombinant Zebrafish VPS18 | +Inquiry |
VPS18-4979R | Recombinant Rhesus Macaque VPS18 Protein, His (Fc)-Avi-tagged | +Inquiry |
VPS18-4445C | Recombinant Chicken VPS18 | +Inquiry |
◆ Cell & Tissue Lysates | ||
VPS18-397HCL | Recombinant Human VPS18 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VPS18 Products
Required fields are marked with *
My Review for All VPS18 Products
Required fields are marked with *