Recombinant Human VPS4A protein, GST-tagged

• Cat.No.: VPS4A-301457H
• Product Overview: Recombinant Human VPS4A (86-437 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Lys86-Ser437
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: KENQSEGKGSDSDSEGDNPEKKKLQEQLMGAVVMEKPNIRWNDVAGLEGAKEALKEAVILPIKFPHLFTGKRTPWRGILLFGPPGTGKSYLAKAVATEANNSTFFSVSSSDLMSKWLGESEKLVKNLFELARQHKPSIIFIDEVDSLCGSRNENESEAARRIKTEFLVQMQGVGNNNDGTLVLGATNIPWVLDSAIRRRFEKRIYIPLPEEAARAQMFRLHLGSTPHNLTDANIHELARKTEGYSGADISIIVRDSLMQPVRKVQSATHFKKVCGPSRTNPSMMIDDLLTPCSPGDPGAMEMTWMDVPGDKLLEPVVCMSDMLRSLATTRPTVNADDLLKVKKFSEDFGQES
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: VPS4A vacuolar protein sorting 4 homolog A (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: VPS4A
• Synonyms: VPS4A; vacuolar protein sorting 4 homolog A (S. cerevisiae); vacuolar protein sorting 4A (yeast homolog) , vacuolar protein sorting 4A (yeast); vacuolar protein sorting-associated protein 4A; FLJ22197; SKD1; SKD1A; SKD2; VPS4; VPS4 1; hVPS4; SKD1-homolog; vacuolar sorting protein 4; vacuolar protein sorting factor 4A; VPS4-1
• Gene ID: 27183
• mRNA Refseq: NM_013245
• Protein Refseq: NP_037377
• MIM: 609982
• UniProt ID: Q9UN37