Recombinant Human VPS4A protein, GST-tagged

Cat.No. : VPS4A-301457H
Product Overview : Recombinant Human VPS4A (86-437 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Lys86-Ser437
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : KENQSEGKGSDSDSEGDNPEKKKLQEQLMGAVVMEKPNIRWNDVAGLEGAKEALKEAVILPIKFPHLFTGKRTPWRGILLFGPPGTGKSYLAKAVATEANNSTFFSVSSSDLMSKWLGESEKLVKNLFELARQHKPSIIFIDEVDSLCGSRNENESEAARRIKTEFLVQMQGVGNNNDGTLVLGATNIPWVLDSAIRRRFEKRIYIPLPEEAARAQMFRLHLGSTPHNLTDANIHELARKTEGYSGADISIIVRDSLMQPVRKVQSATHFKKVCGPSRTNPSMMIDDLLTPCSPGDPGAMEMTWMDVPGDKLLEPVVCMSDMLRSLATTRPTVNADDLLKVKKFSEDFGQES
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name VPS4A vacuolar protein sorting 4 homolog A (S. cerevisiae) [ Homo sapiens ]
Official Symbol VPS4A
Synonyms VPS4A; vacuolar protein sorting 4 homolog A (S. cerevisiae); vacuolar protein sorting 4A (yeast homolog) , vacuolar protein sorting 4A (yeast); vacuolar protein sorting-associated protein 4A; FLJ22197; SKD1; SKD1A; SKD2; VPS4; VPS4 1; hVPS4; SKD1-homolog; vacuolar sorting protein 4; vacuolar protein sorting factor 4A; VPS4-1;
Gene ID 27183
mRNA Refseq NM_013245
Protein Refseq NP_037377
MIM 609982
UniProt ID Q9UN37

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All VPS4A Products

Required fields are marked with *

My Review for All VPS4A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon