Recombinant Human VPS4A protein, His&Myc-tagged
Cat.No. : | VPS4A-6744H |
Product Overview : | Recombinant Human VPS4A protein(Q9UN37)(1-437aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 1-437a.a. |
Tag : | His&Myc |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 53.9 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MTTSTLQKAIDLVTKATEEDKAKNYEEALRLYQHAVEYFLHAIKYEAHSDKAKESIRAKCVQYLDRAEKLKDYLRSKEKHGKKPVKENQSEGKGSDSDSEGDNPEKKKLQEQLMGAVVMEKPNIRWNDVAGLEGAKEALKEAVILPIKFPHLFTGKRTPWRGILLFGPPGTGKSYLAKAVATEANNSTFFSVSSSDLMSKWLGESEKLVKNLFELARQHKPSIIFIDEVDSLCGSRNENESEAARRIKTEFLVQMQGVGNNNDGTLVLGATNIPWVLDSAIRRRFEKRIYIPLPEEAARAQMFRLHLGSTPHNLTDANIHELARKTEGYSGADISIIVRDSLMQPVRKVQSATHFKKVCGPSRTNPSMMIDDLLTPCSPGDPGAMEMTWMDVPGDKLLEPVVCMSDMLRSLATTRPTVNADDLLKVKKFSEDFGQES |
Gene Name | VPS4A vacuolar protein sorting 4 homolog A (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | VPS4A |
Synonyms | VPS4A; vacuolar protein sorting 4 homolog A (S. cerevisiae); vacuolar protein sorting 4A (yeast homolog) , vacuolar protein sorting 4A (yeast); vacuolar protein sorting-associated protein 4A; FLJ22197; SKD1; SKD1A; SKD2; VPS4; VPS4 1; hVPS4; SKD1-homolog; vacuolar sorting protein 4; vacuolar protein sorting factor 4A; VPS4-1; |
Gene ID | 27183 |
mRNA Refseq | NM_013245 |
Protein Refseq | NP_037377 |
MIM | 609982 |
UniProt ID | Q9UN37 |
◆ Recombinant Proteins | ||
VPS4A-10072M | Recombinant Mouse VPS4A Protein, His (Fc)-Avi-tagged | +Inquiry |
VPS4A-18380M | Recombinant Mouse VPS4A Protein | +Inquiry |
VPS4A-5172R | Recombinant Rhesus monkey VPS4A Protein, His-tagged | +Inquiry |
VPS4A-6545R | Recombinant Rat VPS4A Protein | +Inquiry |
VPS4A-4503Z | Recombinant Zebrafish VPS4A | +Inquiry |
◆ Cell & Tissue Lysates | ||
VPS4A-1914HCL | Recombinant Human VPS4A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All VPS4A Products
Required fields are marked with *
My Review for All VPS4A Products
Required fields are marked with *
0
Inquiry Basket