Recombinant Human VPS4A protein, His-tagged
| Cat.No. : | VPS4A-7854H |
| Product Overview : | Recombinant Human VPS4A protein(86-437 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 86-437 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | KENQSEGKGSDSDSEGDNPEKKKLQEQLMGAVVMEKPNIRWNDVAGLEGAKEALKEAVILPIKFPHLFTGKRTPWRGILLFGPPGTGKSYLAKAVATEANNSTFFSVSSSDLMSKWLGESEKLVKNLFELARQHKPSIIFIDEVDSLCGSRNENESEAARRIKTEFLVQMQGVGNNNDGTLVLGATNIPWVLDSAIRRRFEKRIYIPLPEEAARAQMFRLHLGSTPHNLTDANIHELARKTEGYSGADISIIVRDSLMQPVRKVQSATHFKKVCGPSRTNPSMMIDDLLTPCSPGDPGAMEMTWMDVPGDKLLEPVVCMSDMLRSLATTRPTVNADDLLKVKKFSEDFGQES |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | VPS4A vacuolar protein sorting 4 homolog A (S. cerevisiae) [ Homo sapiens ] |
| Official Symbol | VPS4A |
| Synonyms | VPS4A; vacuolar protein sorting 4 homolog A (S. cerevisiae); vacuolar protein sorting 4A (yeast homolog) , vacuolar protein sorting 4A (yeast); vacuolar protein sorting-associated protein 4A; FLJ22197; SKD1; SKD1A; SKD2; VPS4; VPS4 1; hVPS4; SKD1-homolog; vacuolar sorting protein 4; vacuolar protein sorting factor 4A; VPS4-1; |
| Gene ID | 27183 |
| mRNA Refseq | NM_013245 |
| Protein Refseq | NP_037377 |
| MIM | 609982 |
| UniProt ID | Q9UN37 |
| ◆ Recombinant Proteins | ||
| VPS4A-4985R | Recombinant Rhesus Macaque VPS4A Protein, His (Fc)-Avi-tagged | +Inquiry |
| VPS4A-18380M | Recombinant Mouse VPS4A Protein | +Inquiry |
| VPS4A-1245HFL | Recombinant Full Length Human VPS4A Protein, C-Flag-tagged | +Inquiry |
| Vps4a-572M | Recombinant Mouse Vps4a Protein, MYC/DDK-tagged | +Inquiry |
| VPS4A-5172R | Recombinant Rhesus monkey VPS4A Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| VPS4A-1914HCL | Recombinant Human VPS4A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VPS4A Products
Required fields are marked with *
My Review for All VPS4A Products
Required fields are marked with *
