Recombinant Human VSIG2 Protein, His-tagged

Cat.No. : VSIG2-3911H
Product Overview : Recombinant Human VSIG2 protein(Val24-Ala243), fused with C-terminal His tag, was expressed in HEK293.
Availability August 23, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : Val24-Ala243
Tag : C-His
Form : Liquid in sterile PBS, pH7.4.
Molecular Mass : The protein has a calculated MW of 25 kDa.
Endotoxin : <1.0EU per 1μg (determined by the LAL method).
Purity : > 90 % as determined by SDS-PAGE.
Storage : Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 1.0 mg/ml. Centrifuge the vial at 4°C before opening to recover the entire contents.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : VEVKVPTEPLSTPLGKTAELTCTYSTSVGDSFALEWSFVQPGKPISESHPILYFTNGHLYPTGSKSKRVSLLQNPPTVGVATLKLTDVHPSDTGTYLCQVNNPPDFYTNGLGLINLTVLVPPSNPLCSQSGQTSVGGSTALRCSSSEGAPKPVYNWVRLGTFPTPSPGSMVQDEVSGQLILTNLSLTSSGTYRCVATNQMGSASCELTLSVTEPSQGRVAAHHHHHHHHHH
Gene Name VSIG2 V-set and immunoglobulin domain containing 2 [ Homo sapiens ]
Official Symbol VSIG2
Synonyms VSIG2; V-set and immunoglobulin domain containing 2; V-set and immunoglobulin domain-containing protein 2; CTH; CTXL; CT-like protein; cortical thymocyte-like protein; cortical thymocyte receptor (X. laevis CTX) like; 2210413P10Rik;
Gene ID 23584
mRNA Refseq NM_014312
Protein Refseq NP_055127
MIM 606011
UniProt ID Q96IQ7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All VSIG2 Products

Required fields are marked with *

My Review for All VSIG2 Products

Required fields are marked with *

0
cart-icon