Recombinant Human VSIG2 Protein, His-tagged
| Cat.No. : | VSIG2-3911H |
| Product Overview : | Recombinant Human VSIG2 protein(Val24-Ala243), fused with C-terminal His tag, was expressed in HEK293. |
| Availability | November 24, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | Val24-Ala243 |
| Tag : | C-His |
| Form : | Liquid in sterile PBS, pH7.4. |
| Molecular Mass : | The protein has a calculated MW of 25 kDa. |
| Endotoxin : | <1.0EU per 1μg (determined by the LAL method). |
| Purity : | > 90 % as determined by SDS-PAGE. |
| Storage : | Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 1.0 mg/ml. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | VEVKVPTEPLSTPLGKTAELTCTYSTSVGDSFALEWSFVQPGKPISESHPILYFTNGHLYPTGSKSKRVSLLQNPPTVGVATLKLTDVHPSDTGTYLCQVNNPPDFYTNGLGLINLTVLVPPSNPLCSQSGQTSVGGSTALRCSSSEGAPKPVYNWVRLGTFPTPSPGSMVQDEVSGQLILTNLSLTSSGTYRCVATNQMGSASCELTLSVTEPSQGRVAAHHHHHHHHHH |
| Gene Name | VSIG2 V-set and immunoglobulin domain containing 2 [ Homo sapiens ] |
| Official Symbol | VSIG2 |
| Synonyms | VSIG2; V-set and immunoglobulin domain containing 2; V-set and immunoglobulin domain-containing protein 2; CTH; CTXL; CT-like protein; cortical thymocyte-like protein; cortical thymocyte receptor (X. laevis CTX) like; 2210413P10Rik; |
| Gene ID | 23584 |
| mRNA Refseq | NM_014312 |
| Protein Refseq | NP_055127 |
| MIM | 606011 |
| UniProt ID | Q96IQ7 |
| ◆ Recombinant Proteins | ||
| VSIG2-10083M | Recombinant Mouse VSIG2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| VSIG2-3939H | Recombinant Human VSIG2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| VSIG2-1969HFL | Recombinant Full Length Human VSIG2 Protein, C-Flag-tagged | +Inquiry |
| VSIG2-488H | Recombinant Human VSIG2 Protein, MYC/DDK-tagged | +Inquiry |
| Vsig2-6947M | Recombinant Mouse Vsig2 Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| VSIG2-1915HCL | Recombinant Human VSIG2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VSIG2 Products
Required fields are marked with *
My Review for All VSIG2 Products
Required fields are marked with *
