Recombinant Human VSTM2L, His-tagged
Cat.No. : | VSTM2L-31539TH |
Product Overview : | Recombinant full length Human VSTM2L with N terminal His tag; 205 amino acids with tag, Predicted MWt 22.6 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 180 amino acids |
Conjugation : | HIS |
Molecular Weight : | 22.600kDa inclusive of tags |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 20% Glycerol, 0.58% Sodium chloride, 0.02% DTT, 0.002% PMSF |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMGSHMTRPAGHAPWDNHVSG HALFTETPHDMTARTGEDVEMACSFRGSGSPSYSLEIQWW YVRSHRDWTDKQAWASNQLKASQQEDAGKEATKISVVKVV GSNISHKLRLSRVKPTDEGSYECRVIDFSDGKARHHKVKA YLRVQPGENSVLHLPEAPPAAPAPPPPKPGKELRKRSVDQ EACSL |
Sequence Similarities : | Contains 1 Ig-like (immunoglobulin-like) domain. |
Gene Name | VSTM2L V-set and transmembrane domain containing 2 like [ Homo sapiens ] |
Official Symbol | VSTM2L |
Synonyms | VSTM2L; V-set and transmembrane domain containing 2 like; C20orf102, chromosome 20 open reading frame 102; V-set and transmembrane domain-containing protein 2-like protein; dJ1118M15.2; |
Gene ID | 128434 |
mRNA Refseq | NM_080607 |
Protein Refseq | NP_542174 |
Uniprot ID | Q96N03 |
Chromosome Location | 20q11.23 |
Function | protein binding; |
◆ Recombinant Proteins | ||
VSTM2L-8555H | Recombinant Human VSTM2L protein, His-tagged | +Inquiry |
VSTM2L-31540TH | Recombinant Human VSTM2L, His-tagged | +Inquiry |
VSTM2L-5179R | Recombinant Rhesus monkey VSTM2L Protein, His-tagged | +Inquiry |
VSTM2L-4992R | Recombinant Rhesus Macaque VSTM2L Protein, His (Fc)-Avi-tagged | +Inquiry |
VSTM2L-4691H | Recombinant Human VSTM2L protein, His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
VSTM2L-376HCL | Recombinant Human VSTM2L 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VSTM2L Products
Required fields are marked with *
My Review for All VSTM2L Products
Required fields are marked with *