Recombinant Human VSTM2L, His-tagged
Cat.No. : | VSTM2L-31539TH |
Product Overview : | Recombinant full length Human VSTM2L with N terminal His tag; 205 amino acids with tag, Predicted MWt 22.6 kDa. |
- Specification
- Gene Information
- Related Products
Protein length : | 180 amino acids |
Conjugation : | HIS |
Molecular Weight : | 22.600kDa inclusive of tags |
Source : | E. coli |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 20% Glycerol, 0.58% Sodium chloride, 0.02% DTT, 0.002% PMSF |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMGSHMTRPAGHAPWDNHVSG HALFTETPHDMTARTGEDVEMACSFRGSGSPSYSLEIQWW YVRSHRDWTDKQAWASNQLKASQQEDAGKEATKISVVKVV GSNISHKLRLSRVKPTDEGSYECRVIDFSDGKARHHKVKA YLRVQPGENSVLHLPEAPPAAPAPPPPKPGKELRKRSVDQ EACSL |
Sequence Similarities : | Contains 1 Ig-like (immunoglobulin-like) domain. |
Gene Name : | VSTM2L V-set and transmembrane domain containing 2 like [ Homo sapiens ] |
Official Symbol : | VSTM2L |
Synonyms : | VSTM2L; V-set and transmembrane domain containing 2 like; C20orf102, chromosome 20 open reading frame 102; V-set and transmembrane domain-containing protein 2-like protein; dJ1118M15.2; |
Gene ID : | 128434 |
mRNA Refseq : | NM_080607 |
Protein Refseq : | NP_542174 |
Uniprot ID : | Q96N03 |
Chromosome Location : | 20q11.23 |
Function : | protein binding; |
Products Types
◆ Recombinant Protein | ||
VSTM2L-4992R | Recombinant Rhesus Macaque VSTM2L Protein, His (Fc)-Avi-tagged | +Inquiry |
Vstm2l-6953M | Recombinant Mouse Vstm2l Protein, Myc/DDK-tagged | +Inquiry |
VSTM2L-4691H | Recombinant Human VSTM2L protein, His-SUMO-tagged | +Inquiry |
VSTM2L-4833H | Recombinant Human V-Set And Transmembrane Domain Containing 2 Like, His-tagged | +Inquiry |
VSTM2L-5179R | Recombinant Rhesus monkey VSTM2L Protein, His-tagged | +Inquiry |
◆ Lysates | ||
VSTM2L-376HCL | Recombinant Human VSTM2L 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket